KEGG   Serinus canaria (common canary): 103812734Help
Entry
103812734         CDS       T05755                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00010  Glycolysis / Gluconeogenesis
scan00030  Pentose phosphate pathway
scan00051  Fructose and mannose metabolism
scan00052  Galactose metabolism
scan01100  Metabolic pathways
scan01200  Carbon metabolism
scan01230  Biosynthesis of amino acids
scan03018  RNA degradation
Module
scan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103812734 (PFKP)
   00030 Pentose phosphate pathway
    103812734 (PFKP)
   00051 Fructose and mannose metabolism
    103812734 (PFKP)
   00052 Galactose metabolism
    103812734 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103812734 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:scan01009]
    103812734 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:scan03019]
    103812734 (PFKP)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103812734 (PFKP)
Protein phosphatases and associated proteins [BR:scan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103812734 (PFKP)
Messenger RNA biogenesis [BR:scan03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103812734 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103812734
NCBI-ProteinID: XP_009084068
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MDHQPKFFENLSGAGKAIAVLTSGGDAQGMNAAVRAVVRMGIYVNAKVYFIYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAACNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDAEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DTMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKELVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFLEAVRLRGRSFENNLNTYKLLSHKKPDAELPKSNFNVAVLNVGAPAAGMNAAV
RAAVRVGMTEGHKIFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKEGGKVFANTDDSVCLLGMRRRN
LVFQPVAELKSETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMLPKEA
ESGAI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagcccaagttcttcgagaacctctcgggtgccgggaaggccatcgcggtg
ctgaccagcggcggcgatgcccaaggtatgaacgctgctgtgcgcgctgtagtacgcatg
ggaatctatgtaaatgccaaagtctattttatttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcgagtatcctgcaagtggga
ggcacggtgatcggcagcgcgcgctgcaaatccttccgcacgcgcgagggccgcctgcag
gctgcctgcaacctggtgcagagaggcatcaccaacctctgcgtgatcggcggcgacggc
agcttgactggtgccaacctcttccgggaggagtggagtgggctgctggaagagctggca
cagaaaggaaagattgatgcagaggctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgaccataggtactgactca
gctctgcacagaataattgaagttgtggatgccatcatgaccactgctcagagccatcag
aggacatttgtcctggaggttatggggagacactgtggctatctagctctggttagtgcc
ttagcctgtggtgcagattgggtgtttattcctgaatacccaccagaagaaggttgggaa
gatacaatgtgtgtgaagctttcagagaaccgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgccacaacaaacctataacatcagagaaggttaag
gagcttgtggttcagcggcttggttttgacacccgggtaaccatcctgggccatgtgcaa
agaggtggaaccccttcagcttttgacagaattcttgcgagtcgtatgggtgtggaagcc
gtgcttgcccttttagaagctactccagatacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctctgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgagggaagatttcttgaggctgtgaggcttcgtggaaggagctttgaaaac
aaccttaacacgtacaaattactgtcgcacaaaaagccagatgctgagcttccaaagtct
aattttaatgtggcagttttaaatgtgggggcccctgcagctggaatgaacgccgccgtg
agggctgcagtgagagttggcatgactgaaggtcacaaaatatttgctgtcattgatggt
tttgaagggttcgccagagggaagataaaggaaatttcctggggagatgttggaggctgg
actggtcaaggaggatcaattctcggtacaaaacgtactcttcctgcaaaatatttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcttaccttggacttctggaattgtcagcagcccgggagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatctaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgaccgcatcaagcagtcg
gccagcggcaccaagcgccgcgtgttcatcatcgagaccatgggcggctactgcggctac
ctggccaacatgggggccctggcagcaggagctgatgctgcctacatctttgaagagcag
tttgatatcagagagctccaggctaatgtggaacacttgactgagaaaatgaaaaccagt
atccagcgtggtctagtgctgagaaatgagaattgcaatgagaactacacaactgatttc
atttatcagctgtattctgaagaaggaaaaggagtgtttgactgtcgaaaaaatgtattg
ggccatatgcagcagggtggagcaccttcaccatttgatagaaattttgggacaaaaatt
tcagcaaaagctatgcagtggatctccaaaaaactgaaggaaacctaccggaaagaagga
ggaaaagtatttgccaataccgatgactcagtctgtttgctgggaatgcggagacgcaac
cttgttttccaacctgtggctgagctgaagagtgaaacagactttgtacacaggattccc
aaggagcagtggtggctgaagctgcgaccgctgatgaagatcctggccaagtacaagacc
agctatgatgtgtcagactcaggccagctggaacatgtggccatgctcccaaaggaagct
gagagcggagccatctaa

DBGET integrated database retrieval system