Serinus canaria (common canary): 103813288 Help Entry 103813288         CDS       T05755                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism scan  Serinus canaria (common canary) Pathway scan03420   Nucleotide excision repair scan04110   Cell cycle scan04114   Oocyte meiosis scan04120   Ubiquitin mediated proteolysis scan04141   Protein processing in endoplasmic reticulum scan04310   Wnt signaling pathway scan04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:scan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103813288 (RBX1)    04120 Ubiquitin mediated proteolysis     103813288 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     103813288 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103813288 (RBX1)    04350 TGF-beta signaling pathway     103813288 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103813288 (RBX1)    04114 Oocyte meiosis     103813288 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:scan04121]     103813288 (RBX1)    03400 DNA repair and recombination proteins [BR:scan03400]     103813288 (RBX1) Enzymes [BR:scan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103813288 (RBX1) Ubiquitin system [BR:scan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103813288 (RBX1)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      103813288 (RBX1)    Cul2 complex      103813288 (RBX1)    Cul3 complex      103813288 (RBX1)    Cul4 complex      103813288 (RBX1)    Cul7 complex      103813288 (RBX1)    Cul8 complex      103813288 (RBX1)    Cul9 complex      103813288 (RBX1) DNA repair and recombination proteins [BR:scan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103813288 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       103813288 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  103813288 NCBI-ProteinID:  XP_009084781 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggacacccccagcggaaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgccgtcgctctgtgggcatgggacatcgtggttgat aactgtgccatttgcagaaaccacattatggatctgtgcatagaatgtcaagccaaccaa gcatcggctacctctgaggagtgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgtcccctggacaaccgggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system