KEGG   Serinus canaria (common canary): 103813489Help
Entry
103813489         CDS       T05755                                 

Gene name
TUBGCP6
Definition
(RefSeq) gamma-tubulin complex component 6
  KO
K16573  gamma-tubulin complex component 6
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:scan03036]
    103813489 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:scan04812]
    103813489 (TUBGCP6)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     103813489 (TUBGCP6)
Cytoskeleton proteins [BR:scan04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     103813489 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl GCP_C_terminal GCP_N_terminal DUF4573 STAR_dimer
Motif
Other DBs
NCBI-GeneID: 103813489
NCBI-ProteinID: XP_009085049
LinkDB All DBs
Position
Unknown
AA seq 2434 aa AA seqDB search
MASGTALIYDEEMTSHKLLWSDPICDIEVPERLSSSYEQLRSYHLVERCVHVPAREGSEE
EILLVHSFEHLEVAKSTQTMNEDELKRVSENYDAFFFHPSSYHCARLAVGAALQLVDAVM
AGKVRNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKQKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAAFFHVLLPMAFEFDPELVIVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLANGKLC
VILEGGYHLKSLGESVCMTVKTLLGDPVPQITGEMAPCLSAVESIQNVRAAHKPYWKWLA
YEDTSFVQNLSTKSHLKKANSNPSTEDESQITKNNTVKVERFLELHMQNILFPVPPIKTA
TTGSEGSEHLLPEHVHLVKEMDKTEIKALVSDFYADLVKEDKTLLSLGSMFVILDKILKK
EVCNGIAASPTAALSAAVALRHSVRFGFQRVLCVFVGDMQMIPNTEDGKMLVINICEKEQ
SRKTSSKHYISLNWKEDAGGNDFFSAVLGFILPVAYSYQPNLTVIAVGPNRNLGISGISL
LVALLRGLAESRVFAVIEDTEISLMQSVAKALVGASTPPFGIYVPPTQEKVNTIKALRDQ
FQQEWKMLQCSGVPSHEIRDPDRTCQNLTVSSEMESITQLFNDLCEAHLTGLPWKVHLGR
QKISKRRAKQNLKRVAYNALFMNLFQDEARKLQSNVSRLPVKNKILMLSFNLRVAGLGAQ
ADRLENLVEELETAECLPFTEVNSVLDLLVQLAGTGPPQLVPQKKDYFLNNKYVGRNVKY
QGYDYYDVSVFEADIQSLITNEECQFNDAIQQTLQIMEAAPGTGLPAIGLFSQSCPAGDK
FEKETRVSLFGALVHSRTYDMDIKLDLPPVPDNADLSGLAIKVPQSIDQSEDEGFQSASN
LTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWERIGYPPGKKEEPYLTEAGREAFDKFYK
LREGELQLFTNTVLQLPQLVLVKEPELVKDVLNVLIGVVSTTFSLNQAAQSFVIKEGVYV
SGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPVLDSSYSKGLVFQAFTSGLRKYLQYYRA
CVLSTPPTLSLLTISFLFRKLGRQLRYLAELCGIGTTALGISGGAGASFPTGVKLLSYLY
KEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDWVYSGVFRDVYGEFMIQVNEDYLCFRDK
HYWTHGYVLISKEVEDCVPVFLKHIANDVYICGKTINLLKLCCPRHYICWSDIPVPRISV
IFSLEELKEIERDCAVYVGRMERIARYSSISKEEKDLRMEIAKQELIAHARETASKVLKA
ISDKQISERMALDAKKREQFQKLKEQFAKDQERRLAIKQEEIDDDFSYARELREREKRLK
ALEEELEKKTRQELIDHYSKLSDDAARREQRKLWKIQRHKLETARLKFLSEDQKRIEEML
EKLPDGSYRKKLDIIPYKQCPLALDKTPVEKEPPSQVSFVKPLPSNETVGRKESETEQGF
AASAGKALPMPEPTNNNADEHFQPKATGSESNLQNAEKPCSSLYSAESLPESNVNIEDFL
SKSKDEQSIAVRMQGSLLDEAFQNINSDLSETLQVSESQPVLRGAPKEDNAPLHQQSEYD
FSTVLRPSAAWQGHVRVGENVFDVDERRPRWNIHGHASDANIRVGEYVPQVDTYQPHSSP
YGHSSDSHIKSSSCISEVESRRPRWNVHGHVSEGHIKIGEYASEIETSRPRWNIHGHASE
ANIKIGEYVSNVAPARPRWSSHGHASDANIKVGENVSEVASARPRWNIHGHASQSHIRIG
ELVSDTEPLKSRWSPFGHASQSNIQIGEWAPSTENDPIPHRKAIPGASSDSTVQTLLYSE
ELPPAEGSRKEAKPSQVKEETLPQSQTSGSVTDFPDANIKDDKKENTIEKKQEDVVNKDP
SPDSSQSLQREEPEEAISQDTVPQETLSSEANAATTKEREGEEEDAWKKEQAYLKALSDQ
YCIEKYQDSYDLMSEPPVSHLLHHVIPRSYTFPVDPTVQSATDETAVQLSELLSLPVLMK
RSITAPLVSHVSLVNKAIVDYYFVELNVEKHFEALRHFLLMEDGEFAQSLSDLLFEKLGS
GQTPGELLNPLVLNSILNKALQYSLHGDTQLASNLSFALKYLPEMFKPNAPDALSCLELR
YKVDWPLNIVITESCMNKYNKIFSFLLQLKHMVWTLKDVWFHLKRTALVSRASDSVQFRQ
LQLYKHEMQHFVKVIQGYIANQILHVTWCEFGNKLSSVGNLEEIHRTHAEYLNKAIFRGL
LTEKAAPVMNIIHSIFSLILKFRSQLISQSWSFDAGKQMAVHPNFGLMQQSYNTFKYYSH
FLFKVVTKLVNRGYQPHLEDFLLRINFNNYYKDN
NT seq 7305 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcgctgatttatgatgaggagatgaccagtcacaaactactttgg
agtgatcccatttgtgatattgaagtgccagaaagactttcatcctcctatgagcagctt
agaagttaccatcttgtggaaaggtgtgtccatgtgcccgccagagaaggaagcgaggag
gagatcctgttggttcacagttttgagcacttggaagtggcaaaaagcactcagacaatg
aatgaggatgagctgaaaagggtctctgaaaattatgatgcatttttctttcatccgagc
agttaccactgtgccagactagcagtaggagcagctttgcagctggtggatgctgtgatg
gcaggaaaagtacgcaatggaatggcattagtcagacctccaggtcaccacagccagagg
aatgcagctaacgggttctgtttgttcaacaacgtggctattgcagcagaatatgcaaaa
cagaaatatggtctgcagagaatcctaattgttgactgggatgtgcaccatgggcaagga
actcaatatatatttgaagaagatccaagtgttttgtacttttcttggcaccgctatgaa
catcaggaattctggccatcactcaaagaatctgattacgatgctgtgggtctgggaaaa
ggaaaaggttttaacataaatttgccttggaataaggttgggatgggaaattcagattat
cttgctgcgtttttccatgtgttgcttccgatggcttttgagtttgatcctgaactggtt
attgtctcctctggatacgattctggaattggtgaccctgaaggtcagatgaatgccact
cctgaggtttttgcccaccttacccatttcttgatgcagttagctaatggaaagctgtgt
gtcatcctagagggtggataccacttgaaatcattgggtgaatcagtgtgcatgactgta
aaaactttgcttggagatcctgtgcctcaaataactggagaaatggcaccttgtctaagt
gctgttgaatctattcaaaatgtgagagcagcacataaaccctactggaaatggttggct
tatgaagatacatcatttgtgcaaaatttgagcaccaaatcacacttaaagaaggctaat
tcaaatccctccacagaagatgaatctcagataactaaaaacaacactgtcaaagtggaa
aggtttttggaattgcacatgcaaaatattctatttccagtgcctcccatcaaaacagca
acaactggctctgaaggttcagaacatttgcttcctgaacacgttcatctggtgaaggaa
atggacaaaacagaaataaaagctcttgtcagtgacttttatgcagaccttgtgaaagag
gacaaaactttgctctctcttggcagtatgtttgtgatcctagataaaatacttaagaag
gaggtgtgcaatggaattgcagcatcacccacagctgctctttctgctgctgttgcacta
agacattctgttcgttttggatttcaaagagtgctttgtgtatttgttggagacatgcag
atgatacccaacacagaagatggaaaaatgcttgtcataaacatctgtgagaaagaacag
tctagaaagaccagctccaaacactatatttctctaaactggaaagaggatgctggagga
aatgatttcttttctgctgtacttggattcattcttcctgtagcatatagttatcaacca
aacctaacagtaatagctgttggaccaaacaggaaccttggaataagtgggatttctctg
cttgttgctttactacgaggattagctgagtctcgagtttttgctgtgattgaggacaca
gagataagtttaatgcaaagtgtagccaaagcattagtgggtgcttctacacctcccttt
ggaatttatgtacctcctacccaagaaaaagtaaatacaataaaagcattaagagaccag
ttccaacaggaatggaaaatgcttcaatgttcaggtgttccttcccatgaaatcagagac
ccagaccgtacctgccaaaaccttacggtttcatctgaaatggagagcattacacagttg
ttcaatgacttgtgtgaagcacacctgacaggtttgccatggaaggttcatttaggcagg
cagaagatcagcaagagaagggctaagcaaaatttgaaaagggttgcttataatgccctg
ttcatgaacctttttcaagatgaggctcgtaagctacaatcaaatgtttccagactccca
gtgaagaacaaaattttgatgctgtctttcaacttgagagtcgctggcctaggtgctcaa
gcagatagactggagaatcttgtggaggaactggaaacagctgaatgtttaccatttact
gaagttaattctgtcttagatctcctagtacagcttgctggaacaggtcctcctcagctg
gtaccacaaaaaaaggactattttctgaacaacaaatatgttgggaggaatgtcaaatac
cagggttacgattattatgatgtaagtgtgtttgaagctgacatacagtctctgataaca
aacgaagaatgtcagttcaacgatgcaatccagcagacacttcagataatggaggctgcc
cctggcactgggctccctgccatagggctgttctctcagagctgtcctgctggggacaag
tttgagaaagaaacgcgtgtctctctcttcggtgctcttgtccacagccgtacctatgat
atggacatcaagctggatttaccaccagtgcctgacaatgcagatttgtctggacttgca
attaaagttccccaaagtatagaccagtcagaagatgagggattccagtcagcatccaat
ctgactcctgattctcagtcagagccaagcatgactccagacatagatttgtgggatgca
gtgcttacatatggacccagcaaacgaagatgttgggaaagaattgggtacccacctggt
aaaaaagaggagccgtatcttactgaagctgggagagaagcttttgacaaattttataaa
cttcgagaaggggaattgcaactgtttactaatactgtacttcagcttcctcagcttgtg
ctggtgaaagaacctgaactggttaaggatgtcttgaatgtcctcattggtgtggtatcc
actacattttcactcaatcaggctgctcagtcatttgtgataaaggagggggtgtatgtg
tctggaacatcaccagagacaatgcataacctgctctcggaagttgcagagtatggaacc
tattacacacggctaagtcgtttttctcttcagccagttttggattcctcatacagcaaa
ggacttgtgtttcaggcattcacaagtggactgagaaagtatcttcaatattaccgagcc
tgtgttttgtcaacacctcctactttaagtcttctaacaatcagctttctattcaggaaa
ttaggtcgtcagctcaggtatttagctgaactgtgtggcataggaacaacagcactggga
atcagtggtggagccggtgcttcatttcctacgggtgttaaattgctttcatatctgtac
aaagaggctctcaacaattgtagcaatgagcattatccagttcttctgtctttgttgaag
acaagctgtgaaccatacaccagatttatctatgattgggtatatagtggtgtattcaga
gatgtttatggagaatttatgattcaggtgaatgaggattatctttgtttcagagataaa
cattactggactcatggttatgttttgatttcaaaagaagtagaagactgtgtccctgta
tttcttaagcatattgctaatgatgtatacatatgtgggaaaactataaacttgctgaaa
ttgtgctgtcctaggcattatatatgttggtcagatatacctgttccccggatttcagtt
attttttcccttgaagaactgaaagaaatagagagagattgtgcagtgtacgtaggtcga
atggaaagaattgctcgatacagttccataagcaaggaggaaaaggatttgcgcatggaa
atagccaaacaagaattaattgctcatgctcgggaaactgctagcaaagtactgaaagcc
attagtgacaagcaaatatcagaacgaatggctttggatgcaaagaaacgggaacagttt
cagaagctgaaagaacagtttgcaaaggaccaagagcgtcgtcttgcgataaagcaggag
gagattgatgatgatttcagctatgctcgagagctcagagagagagaaaaaagactgaaa
gctttagaagaagaactggaaaaaaagacaaggcaggaattaattgaccattatagcaaa
ctttctgatgatgcagcccgtagggaacaaagaaaattatggaaaatccagcgccacaag
ttggaaacagcccgtcttaagtttctgtcagaagatcaaaaacgcattgaggaaatgctt
gaaaaacttccagatgggagctacaggaaaaaattagatattattccttataaacagtgc
ccactggctttggataaaacccctgttgagaaagagccaccttcacaagtgtcttttgtg
aaacctcttccttctaatgagacagttggcagaaaagaatctgagactgaacagggtttt
gctgcttctgctggcaaagcactgcctatgccagagccaacaaataataatgctgatgaa
cattttcagcctaaagcaacaggatctgaaagcaatctccaaaatgcagagaaaccatgc
agttctctatacagtgctgagtccttgcctgaatccaatgtgaatatagaagatttctta
tcaaagtcaaaagatgaacagtctattgctgtcaggatgcaaggatctttgctagatgaa
gcattccaaaatattaactcagatctttctgagactttgcaagtgagtgaaagtcagcct
gtcttgagaggagcacccaaagaagacaatgcaccattgcatcagcaaagcgagtatgat
ttcagtacagttctcagaccgtctgcagcttggcagggacatgttagagttggggaaaac
gtgtttgatgtggatgagagaaggcctcggtggaatattcatgggcatgcatctgatgcc
aacattagggtgggagaatatgtacctcaagtggacacttaccagccacattcaagtcct
tatgggcattcttcagattcccatataaaaagcagcagctgtatttctgaagttgagtct
aggcgacctcgatggaatgttcatgggcatgtttctgaaggtcatattaaaattggggaa
tatgcttcagagatagagacctcaaggcccaggtggaacatccatggtcatgcttcagaa
gccaatattaagattggggagtatgtgtcaaatgtagctcctgcaaggcctcgatggagc
agccatggtcacgcatctgatgccaatatcaaggttggtgaaaacgtgtcagaagtggcc
tcagccaggcctcgttggaacatccatgggcacgcctcgcagtcacacatcagaattgga
gagctggtttcggatacagagcctttgaaatcccgttggagcccctttggacacgcatcc
cagtcaaacatccaaataggggagtgggccccatctacagaaaatgatcccatacctcac
cgtaaagccattccaggtgcttcatccgactccacagttcagacacttctgtacagtgaa
gagttacctcctgctgaagggagcagaaaggaagcaaaaccatcacaagttaaggaagag
actttgccacagtcacagacatctggcagtgttacagactttcctgatgctaatattaaa
gatgataaaaaggaaaatacaatagaaaagaaacaagaagatgttgtcaacaaggaccct
tctccagattcctcacagagcttacagagagaagaacctgaagaggccatttctcaagat
actgtgcctcaggaaactttatcttcagaagctaatgcagccacaactaaggagagagaa
ggcgaagaggaagatgcatggaagaaagaacaagcctatttgaaagccttatcggatcag
tattgtattgaaaagtaccaagatagttatgatttaatgtcagaaccaccagtttctcat
ctcttgcatcatgtgataccaagatcatacacatttcctgtggatcctacagtgcagtct
gcaacagatgaaactgctgtacagctgagtgagctcttgtctctgccagtgctgatgaaa
cgttctattactgctccacttgtatctcatgtttctcttgtgaacaaagcaatagttgat
tactactttgtggagctcaatgtagagaagcattttgaagcattgagacactttttgtta
atggaagatggggagtttgctcagtcactcagtgacctgttgtttgagaagcttggatca
ggacaaacacctggtgaattgctgaatccactggttcttaattctatcctaaataaagcc
ctacagtacagtcttcatggtgacacccagcttgcttccaatctttcttttgccctcaag
tatctcccagaaatgttcaagcccaatgcaccagatgctctgagttgcttagagctcagg
tacaaggttgactggcctcttaacattgtcattactgagagctgcatgaataaatacaac
aagattttctcctttttgcttcagctgaagcacatggtgtggactctcaaggatgtttgg
tttcacttaaagcgcactgctttagtgagtcgtgcatcagattctgtccagtttcgacag
ctccagctgtataaacatgagatgcagcattttgtgaaagtaattcaaggttacattgct
aatcagatccttcatgttacgtggtgtgaatttggaaacaaactgtcttctgtgggtaac
ctggaagaaattcacagaacacatgctgaatacctcaacaaagcaatcttcaggggtctg
ttgacagagaaggcagcccctgtgatgaacatcatacacagcatcttcagcctcattttg
aagttccgcagccagctcatctctcagtcgtggagcttcgatgcagggaagcaaatggct
gttcatcccaactttggtctgatgcagcagtcctacaataccttcaagtattactcccat
ttcttattcaaagtggtaacaaagcttgtaaatagaggataccaaccacatctggaggac
tttctgctgcgaattaactttaataactactacaaggataactga

DBGET integrated database retrieval system