KEGG   Serinus canaria (common canary): 103813653
Entry
103813653         CDS       T05755                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103813653 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103813653 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:scan04052]
    103813653 (KITLG)
Cytokines and growth factors [BR:scan04052]
 Growth factors
  Growth factors (RTK binding)
   103813653 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 103813653
NCBI-ProteinID: XP_030094013
LinkDB
Position
Unknown
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPSHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTPENDS
RVAVTKTFLFPPVAASSLRNDSIGSSTSSNKEALGFINSSSLQGISIALTSLLSLLIGFI
LGAIYWKKIHPKSRPESDETTQCHDYQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactcctcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaag
atggatagtctgcctagtcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcagatattccagatatgtcggatgttttaagcaac
tattcaatcatcaataatctcacaaggataattaatgatcttatggcatgccttgctttt
gataaaaacaaggattttgtaaaagaaaatggtcacctttatgaagaaggtcacttcatt
cctgaggatttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agactggataagaacgactgcattctgccttcaacagtaggaacaccggagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactagcagtaacaaagaagcacttggcttcattaacagctcc
agcctgcaagggatcagcatagcactgacatcattgctgtctctccttattggctttatt
ttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcatgactatcaagaggaaaatgagataagtatgttgcagcaaaaagaaaaa
gaacatctacaagtgtag

DBGET integrated database retrieval system