KEGG   Serinus canaria (common canary): 103813840
Entry
103813840         CDS       T05755                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00480  Glutathione metabolism
scan00980  Metabolism of xenobiotics by cytochrome P450
scan00982  Drug metabolism - cytochrome P450
scan00983  Drug metabolism - other enzymes
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103813840
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103813840
   00982 Drug metabolism - cytochrome P450
    103813840
   00983 Drug metabolism - other enzymes
    103813840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scan02000]
    103813840
Enzymes [BR:scan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103813840
Transporters [BR:scan02000]
 Other transporters
  Pores ion channels [TC:1]
   103813840
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 103813840
NCBI-ProteinID: XP_009085449
LinkDB
Position
Unknown
AA seq 242 aa
MSGDHSRSLGKGSAAPGPVPAGLIRLYSMRFCPYAQRTRLVLRAKGISHEIININLKNKP
DWYFEKNPAGLVPVLETSKGQLIWESPITCEYLDEAFPEKKLMPSDPYERACQKMLLEDF
SKITPLLFKHVLAVRDGQDTTALKAEIAEKFGKLEEVLSKRNTVFYGGDSVSMVDYMIWP
WFERLEPFQLKDSLNNTPKLQRWMEAMKEDPAIKATITDPQIYKNYLQLYLKNSPEACDY
GL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtcgggcgatcactctcgcagtctgggcaagggcagcgcggcgccgggcccggtgccc
gcggggctgatccggctctacagcatgcgcttctgcccctacgcgcagcggacgcgcctg
gttctccgcgccaagggcatcagccatgaaataatcaacatcaatctgaagaacaaacct
gactggtactttgagaagaaccccgctgggctggttcctgttctggagaccagcaagggc
cagctgatctgggagtccccaatcacctgtgagtacttggatgaagcatttccagagaag
aagctgatgccttcagacccctatgagcgagcttgtcagaagatgctcttggaagacttc
tcgaagataacacccttgcttttcaagcatgttttggcagtcagagatggacaggacacc
actgcactgaaagcggagattgctgaaaagtttggcaaacttgaagaggttctgtccaaa
cgcaacacggtgttttatggtggggactcagtctcaatggttgactacatgatctggcca
tggtttgaacgtctggaaccattccagctgaaggactctttgaataacaccccaaagctc
caacgctggatggaggccatgaaagaagaccctgctatcaaggctacgataactgaccca
cagatatacaaaaactacctccagctgtatctgaagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system