KEGG   Serinus canaria (common canary): 103814596Help
Entry
103814596         CDS       T05755                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103814596 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:scan03036]
    103814596 (HDAC4)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103814596 (HDAC4)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103814596 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103814596
NCBI-ProteinID: XP_018767416
LinkDB All DBs
Position
Unknown
AA seq 1102 aa AA seqDB search
MVRTLRCPGSARSAAGRDVPDGLSGRDQPVELLNPPRVNHMPSSVDVSTALPLQVAPSSV
PMDLRLDHQFSMPVTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQ
LHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVA
STEVKMKLQEFVLNKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNH
PVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDV
TGTADSACNSAPGSGPSSPNNSSNNISTENGIAGSVTSIQAETSLAHRLVNREGSVTQLP
LYTSPSLPNITLGLPATGPSSAGQAQQDAERLAIPALQQRISLFPGTHLTPYLSTTTLER
DGGTAHNPLLQHMVLLEQPTAQTPLVTDWYLSGLPLHAQPLVGGDRVSPSIHKLRQHRPL
GRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIISKPAEPARQHESHP
EETEEELREHQALLEEPYGERAAGHKEPPALGSVVQVKQEPIESDEEEAEPQQELEAGQR
QAEQELLFRQQALLLEQQRIHQLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMS
VQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIR
GRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIW
NEVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAA
KLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGT
GAGVGFNVNMAFTGGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTP
LGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPE
KVFQQRANANAVHSMEKVIEIHSKYWHSLQRFASTVGYSLVEAQKCENEEAETVTAMASL
SVGVKPAEKRPEDEPMEEEPPL
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggtcaggacgctgcgctgccccgggagcgcccgcagcgctgcgggacgcgatgtgcca
gatgggctttctggcagagaccagccagtggagctgttgaatccacctcgagtgaaccac
atgcccagctctgttgacgtcagcacagccctgcccttgcaagtggcgccgagctcggtg
cccatggacctgcggctggaccaccagttctccatgccggtgacggagcccacgctgcgg
gagcagcagctgcagcaggagctgctggccctcaagcagaagcagcagatccagaggcag
atcctgatcgcagagttccagcggcagcacgagcagctctcccggcagcatgaggcacag
ctgcacgagcacatcaagcagcagcaggagatgctggccatgaagcatcagcaggagctg
ttggagcaccagaggaagttggagcagcaccggcaggagcaggagctggagaagcagcac
cgagagcagaaactgcagcagctgaaaaacaaagagaaagggaaagagagtgcagtggca
agcacagaagtgaagatgaaattgcaggaattcgtgttgaacaagaagaaggctctggcc
caccggaatctcaaccactgcatatccagcgaccctcgcttctggtatgggaagacccag
cacagctctctggaccagagctccccaccccaaagcggcgtctccggcacctacaaccac
ccagtcctggggatgtacgattccaaagacgacttcccactcagaaaaacagcctctgag
cccaacctgaagctgcgttccagactaaagcagaaggtggcagagaggaggagcagcccc
ctcctgcgcaggaaggacgggcccgtggtcacggcgctcaagaagcgcccgctggacgtc
acaggtacggcggactctgcatgcaacagcgctcctggatctggtcccagctctccgaac
aacagctccaacaacatcagcactgagaatggaattgcaggatcagtcaccagtatccag
gcagagaccagcctggctcacaggctcgtgaaccgcgagggctccgtgacgcagctcccg
ctctacacctcaccctccctgcccaacatcacactgggactgcctgccaccggcccctcc
agcgcgggacaagcgcagcaggacgcagagaggctcgcaatcccagccttacagcagcgg
atctccttattccctggcactcacctcactccctacctgagcactacaacgttggagagg
gatgggggaactgcacacaaccctctcctgcagcacatggtcctactggaacagccaact
gcacaaacgcccctggtcacagactggtatctttcaggactgcccctgcacgcacagccc
ctggtgggtggagacagggtctccccttcgatccacaagctgcggcagcaccgcccgctc
gggcgcacccagtctgctcccctgccccagaacgcccaggccctccagcagctggtgatc
cagcagcagcaccagcagttcctggagaaacacaaacagcagttccagcagcagcagctg
cacatcaacaagatcatctccaaacccgcggagccggcgcggcagcacgagagccacccc
gaggagacggaggaggagctgcgggagcaccaggcgctgctggaggagccctacggcgag
cgggccgcgggccacaaggagcccccggcgctgggcagcgtggtgcaggtcaagcaggag
cccatcgagagcgacgaggaggaggcagagccgcagcaggagctggaggccgggcagagg
caggcggagcaggagctgctcttccgccagcaagccctgcttctggagcagcagcggatt
caccagctgaggaactaccaggcgtcgctggaggcggccggcatgcccgtgtcctttggg
ggacaccggcccctgtcccgggcacagtcctcccctgcctcagccaccttccccatgtcc
gtgcaggagccacccactaagccaaggttcacaacaggccttgtgtatgacaccttgatg
ctgaagcaccagtgcacctgtggaaacaccaacagccaccctgagcatgcaggcaggatc
cagagcatctggtccaggctccaggagacggggctgaggggcaagtgtgagtgcatccgt
ggcaggaaggcgacgctggaggagctgcagacggttcactcggaagcgcacacactgctc
tacggcacaaaccctctgaacaggcagaaactggacagcaagaaacttctaggttcccta
acgtcgatgtttgtcaggctgccttgcggtggtgtcggggtcgacagtgacaccatttgg
aacgaggtgcactcgtcgggcgccgctcgcctggccgtgggctgtgtcatcgagctggtg
ttcaaggtggccacaggagagctgaagaatggatttgctgttgtccggcccccgggtcac
cacgcagaggagagcacacccatgggtttctgctattttaactccgtggcaatcgcagcc
aagctgctccagcaaaggctcaacgtgagcaaaatcctcattgtggactgggatgtccac
catgggaatggtactcagcaggccttctacaacgaccccaacgtcctctatatctcactc
catcgctacgatgacggcaacttcttcccgggcagcggcgctccagatgaggttggcaca
ggagcaggagttggtttcaacgttaacatggcatttactggtggtctggatccgcccatg
ggagacacggaatatttaactgccttcaggacagtagtgatgcccattgccaacgagttt
gccccagatgttgtgctggtgtcatctggttttgatgctgtggaagggcaccccacaccc
ctgggaggatataacctgtctgcaaaatgcttcgggtacctgacgaagcagctgatgggg
ctggccgggggccgcgtggtgctggccctcgagggtggccacgacctcacggccatctgc
gacgcctcggaggcttgtgtgtctgccctgctgggaaacgagcttgaccctcttccagag
aaggttttccagcagagagcaaatgctaacgccgtgcattccatggagaaggtcatcgag
atccacagcaagtactggcattctctccagcgtttcgcctccacggtgggatattccctg
gtggaggcccagaagtgtgagaacgaggaggcagagacagtgacggccatggcatcgctg
tcggtgggtgtgaagccggcggagaagagacctgaggacgaacccatggaagaggagcct
cccctgtag

DBGET integrated database retrieval system