KEGG   Serinus canaria (common canary): 103816000Help
Entry
103816000         CDS       T05755                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103816000 (MAPK6)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103816000 (MAPK6)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103816000 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 103816000
NCBI-ProteinID: XP_009088158
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVADEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HESTDVDKLNDLNSSVSQIELKGIISKSVSREKQEKGMANLAQLEALYQTSWDSQFVSGG
EGCFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKEREES
FLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcgttat
atggacttaaaaccactgggctgtggtggaaatggcttagttttttctgctgtcgataat
gactgtgacaaaagagtagctgtcaagaaaattgtccttacagatccccagagtgttaag
catgctctacgtgagatcaaaattattagaaggcttgaccacgacaacattgtgaaagta
tttgaaattcttggtcccagtggaagccagttaacagatgacgtgggctccctgacagaa
ttgaactgtgtttacattgtccaggaatacatggagacagatctggctaatttgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaatgttctgcatagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagattggtgactttggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttacgaaatggtacagatcgccc
cggcttttgctttctcctaacaactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagttgattctagaatcaattccggtcgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ctgcttccaggcatcagtcctgaagcgctggactttctggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttatatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctaatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctttctgacgttgctgatgaagaagaagtgcaagtggatcctcgcaaa
tatttggatggagatcgtgaaaagtacctggaggatcctgcctttgacacccacttctct
actgagccttgctggcagtattcagatcaccacgaaaacaagtattgtgatctggaatgt
agtcacacttgtaattacaaaatgaggtcctcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcaaactggaag
gaacaaagcaaagaaaagtctgacaagaaaggcaagtctaaatgtgaaaagaatgggttg
gtgaaagctcagatagcacttgaggaagcatcacagcaacttgttgaaaaagaaagggag
aagaatcaggggtttgactttgattcttttatagcagaaaccatccagcttagtttacaa
catgagtctactgatgttgataaattaaatgacttgaatagttcagtgtctcagatagag
ttgaaaggaataatatcgaagtcggtgagcagagagaagcaggagaaaggaatggccaat
ttggcacagttagaagctctgtaccaaacttcttgggacagtcagtttgtcagtggtggg
gaggggtgcttcctcatagaccagttctgttgcgaagtaaggaaggatgaacaagttgaa
aaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagatgctgaa
atgctagaacctgagccagtagaagaggggaagcttggggagaaggaaagagaagagagc
tttctcagtaacagtggggagctcctcttcaacaagcagcttgaggctataggtattcct
cagtttcacagccccgttggttcgcctctcaagtccatccaggccacgctaacgccttct
gctatgaaatcatctccccagattccccacaaaacctacagcagcattctgaaacatcta
aactaa

DBGET integrated database retrieval system