KEGG   Serinus canaria (common canary): 103818306Help
Entry
103818306         CDS       T05755                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00010  Glycolysis / Gluconeogenesis
scan00053  Ascorbate and aldarate metabolism
scan00071  Fatty acid degradation
scan00280  Valine, leucine and isoleucine degradation
scan00310  Lysine degradation
scan00330  Arginine and proline metabolism
scan00340  Histidine metabolism
scan00380  Tryptophan metabolism
scan00410  beta-Alanine metabolism
scan00561  Glycerolipid metabolism
scan00620  Pyruvate metabolism
scan01100  Metabolic pathways
Module
scan_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103818306 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103818306 (ALDH2)
   00620 Pyruvate metabolism
    103818306 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103818306 (ALDH2)
   00561 Glycerolipid metabolism
    103818306 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103818306 (ALDH2)
   00310 Lysine degradation
    103818306 (ALDH2)
   00330 Arginine and proline metabolism
    103818306 (ALDH2)
   00340 Histidine metabolism
    103818306 (ALDH2)
   00380 Tryptophan metabolism
    103818306 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103818306 (ALDH2)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103818306 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 103818306
NCBI-ProteinID: XP_018772230
LinkDB All DBs
Position
Unknown
AA seq 435 aa AA seqDB search
MLRAVVRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAYNKIFINNEWHDAVSKKTFPTI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVASLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQKEGAKLLCGGNPAADRGYFIQPTVFGDVQDSMTIAREEV
SAAAPQGCLSLQWEM
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtggtgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctataac
aagattttcataaataacgaatggcacgatgcagtcagcaagaaaaccttccccaccatc
aacccagccacgggagaagtcatctgccaggtggccgagggcgataaggcagatgtggac
aaggcagtgaaggcagccaaggcagcgttccagctgggctctccctggaggaggatggat
gcatctcaccgcgggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtcagataaattccat
ggcaaaaccatcccattagatggagacttcttctgctacacaagacacgagcccgtggga
gtctgtgggcaaatcatcccttggaacttcccactgttgatgcaggcatggaaattgggg
cctgccctggccactgggaatgtggttgtgatgaaagtggcagaacaaacccccctgagt
gctctctacgtggccagtctgatcaaagaggccggattccccccgggcgtggtgaacatc
atccctggctacgggcccacggcaggagctgccatctcctcccacatggacattgacaaa
gtggccttcaccggctccacggaggttggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaaggacag
tgctgctgtgctggctccaggacctacgtgcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttggaaacccctttgacttcaaaaccgag
caggggcctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcacgggg
cagaaggagggagccaagctgctgtgtggtggcaaccccgctgcagacaggggctacttc
atccagcccactgtctttggggacgtgcaggacagcatgaccattgccagggaggaggtg
agtgctgcagcacctcagggctgcttgagcttgcagtgggagatgtag

DBGET integrated database retrieval system