KEGG   Serinus canaria (common canary): 103818445Help
Entry
103818445         CDS       T05755                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:scan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103818445 (SOD1)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103818445 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103818445
NCBI-ProteinID: XP_018772362
LinkDB All DBs
Position
Unknown
AA seq 171 aa AA seqDB search
MGREKQSGQRCLGLVAGPFCHLRLTRSRAIQSPCGDKCSPLKGTGPVKVTGKITGLADGE
HGFHVHEFGDNTNGCTSAGPHFNPQQKKHGGPSDAERHVGDLGNVTAKGGVAEVSIQDSV
ISLSGPHCIIGRTMVVHERQDDLGKGGNDESLLTGNAGPRLACGVIGIAKS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggacgagaaaaacagtctggacagcgttgccttgggctcgtggcggggcctttctgt
caccttcgtttgacacggagccgtgcaatccaaagtccttgtggtgataaatgctctcct
ttgaagggtactggaccggtgaaagtgactgggaagatcactggattggccgatggagag
cacggcttccacgtccatgagttcggggacaacaccaatgggtgcaccagtgctggcccc
cacttcaacccgcagcagaagaagcacgggggtcccagcgatgctgagaggcacgtggga
gacctgggcaatgtgactgccaagggaggcgtggccgaggtgtccatccaggattccgtc
atttccctctcgggaccacactgcatcatcggccgcaccatggtggtgcacgagaggcag
gatgacctgggcaaagggggcaatgacgagagcctgctgactggaaacgcggggccccgc
ctggcctgcggagtgatcgggattgccaagagctaa

DBGET integrated database retrieval system