KEGG   Serinus canaria (common canary): 103818786Help
Entry
103818786         CDS       T05755                                 

Gene name
MYBL2
Definition
(RefSeq) myb-related protein B
  KO
K21769  myb-related protein B
Organism
scan  Serinus canaria (common canary)
Pathway
scan04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:scan00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103818786 (MYBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scan03000]
    103818786 (MYBL2)
Transcription factors [BR:scan03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    103818786 (MYBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE Sigma70_r4_2 Atg29_N
Motif
Other DBs
NCBI-GeneID: 103818786
NCBI-ProteinID: XP_009091431
LinkDB All DBs
Position
Unknown
AA seq 700 aa AA seqDB search
MCDVPALCPCLVVGLDAECPASVEDQDEPHYQDNDLDVPEQRDGRCKVKWTPEEDEQLKM
LVSHYGQNDWKFLASHFPNRSDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTK
QWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLL
PGRTDNAVKNHWNSTIKRKVDTGGFLNETKESKSLYLLVEVDNKERQSQTTPESQNVLPS
WPVDISEIKEEDVSDDEVTGVQELPLELPAAGVAEQNVEGTPDDAVPEDGTSLVESPYKW
VVEAANYLYPACAPALSEALDMIESDPDGWCDLTQFDLPEEPLAGSGSASPARPAPGEVA
PALPSVTEYRLDGHTISDLSRSSKGELIPISPHAEGSFGTPPSVLKRQKKRKMSLSPVTE
NVASTSMSFLDSCNSMTPKGTPVKTLPFSPSQFLNFWSKQDTLELENPSLTSTPVCSQKV
IVTTPLHRDKTPLLQKNLAFVTPDQTYVADNTPHTPTPFKNALEKYGPIRPLPQTPHLEE
DLKEVLRSEAGIELIIEDDVKPEKQKRKQGLRRSPIKKVRKSLALDIVDEDVTQNLPALP
KTVCFKRAQPVNFLSRSLNLSSSSRKNDSGLLNRAFVQVQPEKMSYRKMPSHFRPPAPMT
RAWKAVACGGTRDQLFMQEKARQFLGTLKQSHTSRTLILS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgttcctgccctgtgtccctgcttggtggtggggctggatgcggagtgtccc
gcctcagttgaggaccaggatgagccacattaccaggataacgatttggatgtgccggag
cagcgggatggcaggtgcaaagtcaagtggaccccagaagaggatgagcagctgaagatg
ttagtgagccattatgggcagaatgactggaagttcctggccagccactttcctaaccgc
agtgaccagcagtgtcagtaccggtggctgagggtgctgaatccagacctggttaagggc
ccatggaccaaagaggaggatcaaaaggtaattgaactggttaaaaagtatggcaccaaa
cagtggacgctgatagccaagcacctgaaagggcggttagggaagcagtgccgggaacgc
tggcacaaccacctgaaccctgaggtgaagaagtcctcatggacagaggaggaggatcgc
atcatatttgaggcccacaaagtcctggggaaccgttgggcagagattgccaagctgctg
cctgggaggactgacaatgctgtgaagaatcactggaactccacaatcaagaggaaagtg
gacacaggaggtttcctcaatgaaactaaggagtccaagtctctgtacttgctcgtggag
gtggataacaaggagaggcaaagtcagacgacacctgagagccagaacgtcctaccaagc
tggccagtggatatctctgaaataaaggaagaagatgtcagtgatgacgaagtgacgggt
gtgcaggagctgcccttggagctgccagctgcaggagtggcagagcagaacgtggagggg
accccagatgatgcagtgcccgaggatggcacttcattggtcgaatcaccatacaaatgg
gttgttgaagctgccaactatttgtacccagcttgtgccccagccctcagtgaagctctg
gacatgattgaatctgacccagatgggtggtgtgacctgacccagtttgacctgcccgag
gagcccttggccggcagcggcagcgccagcccggccagaccggcgcccggtgaggtggcc
ccggcgctgcccagcgtcaccgagtaccgcctggacggccacaccatctctgacctgagc
aggagcagcaagggagagctcatccccatctccccccatgctgagggcagctttggcacc
ccgccctcagtgctgaagaggcagaagaagaggaagatgtccctctcgcctgtcacagag
aatgtggccagcaccagcatgtccttcctggactcctgcaacagcatgacgcccaagggc
acccctgtaaagacactgcccttctctccatctcagttcttgaacttctggagcaaacag
gacacactagaactggagaacccttccctgacctccacgcctgtgtgcagccagaaggtg
attgtcaccaccccactgcacagggacaagacccctctgctccagaagaacttagcgttt
gtcacaccagatcagacctatgtggcggacaacacacctcacactcccacacctttcaaa
aatgccctggagaaatatggaccgattagacctctgccccagactcctcacctggaagaa
gacttgaaggaggtgctccgaagtgaagctggcattgaactcatcatagaggatgatgtg
aagcctgagaaacagaagaggaaacaagggctgcgcaggagccccatcaagaaggtccgg
aagtctctggccctggatattgtggatgaagacgtgacacaaaacctgcctgccctcccc
aagactgtgtgtttcaaaagagcccagcctgtgaatttcctgtcaaggtctctgaacctg
tcctcctcgagcaggaagaatgacagtggtttactcaacagagcctttgtgcaagtgcag
ccagagaaaatgtcctacaggaaaatgccaagccatttcaggccaccagcaccgatgacc
agggcttggaaagcagtggcctgtggtggaactcgagaccaactcttcatgcaggagaaa
gctcgacagtttttgggcacattgaaacagagtcacacatcaaggaccttaatcttatca
tga

DBGET integrated database retrieval system