KEGG   Serinus canaria (common canary): 103819174Help
Entry
103819174         CDS       T05755                                 

Gene name
PNPLA7
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7 isoform X1
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103819174 (PNPLA7)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     103819174 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 103819174
NCBI-ProteinID: XP_018773386
LinkDB All DBs
Position
Unknown
AA seq 1242 aa AA seqDB search
MFYGRKIMRKVTTLPNSLVGNTVPRQRMRKRAKVLSLAKRILRIKKECPTLQRKEPPPSL
LEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFLELCKHMFFVQLHEGEYIFRPGQ
LDDSIYVVQDGKLEVCIQESDGTEVVVKEVLAGDSVHSLLSILDVITGHPAPYKTVSARA
ASPSTILRLPASAFQDVFQKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFSCQSQ
GTPLISVSSITAGAGKAGRRQTPSAVEEERGEKLEKSGEALEMDMLRISGAENSEHVFRR
SLSSPPYAGSTEASNNSSGAKSDMDMAYERARVHLAPEDAAGSPSVAKSILKKTVTVTET
PSAVFHYSAVQDSCNSKHIDAIVEAAKKDLSALMKLDNPALLNGKVTLHQVTAGTVLSRQ
GDQDVNVCFVVSGMLHVYQRKIDSEEDTCLFITHPGELVGQLAVLTGEPLIFTIKANRDC
SFLSISKSHFYEIMREQPSVVLGVAHSVVRRMSPFVRQIDFALDWMEVEAGRAVYRQGDK
SDCTYIVLNGRLRSVLRMDDGKKHLTGEYGRGDLIGVVEALTHQPRATTVHAVRDSELAK
LPEGALISIKRKFPQVVTRLIHLLGEKILGSLQQGGHPLGLHSSSSKWDAGNPASNLSTV
AIMPVSEEVPLTAFTLELKHALSAVGPALLLTSDNIKQRLGSAALDSIHEYRLTSWLGQQ
EDIHRIVLYQADSTLTPWTQRCIRQADCILIVGLGDQEPTVGELERMLENTAVRAQKQLV
LLHKEDGPLPSRTVEWLNMRSWCSAHLHIHCPRRVFSKRSLPKLVEMYERVFQKAPDRHS
DFSRLARVLTGNAIALVLGGGGARGCSQVGVIRALIEAGIPVDMIGGTSIGSFMSALYAE
ERSYNQMRIKARQWAMVMNSVFRTILDLTYPITSMFSGAAFNNSINNIFKDKQIEDLWIP
YFTITTDITASAMRVHRDGSLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADV
ARSMGAKVVIAIDVGSRDETDLTNYGDCLSGWWLLWKRWNPLAEKVKVLNMAEIQTRLAY
VCCVRQLEMVKNSDYCEYIRPPIDRYGTLDFGKFDEICEVGYQHGKTVFNVWCRSGVLDK
MLKDRQETCKSKTDNVTCPTTSFTDLAEIVSRIEPVKAPPLADDESDYQTEYEEEVLDSQ
KDDYLDFSNQAEEDSDSDEEMQLRKRRNVPSGEGQSSTGEPG
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgttctacgggaggaagatcatgaggaaggttacaactcttcccaactctctggttggg
aacaccgtccctcgccaacggatgcggaaacgggcaaaggttttgtctctggctaaaagg
attctgcgtattaagaaggaatgtccaactctgcagaggaaagaacctcctccttctttg
ctagaggcagatctgactgaatttgatgtcaagaattcccacttgccatcagaagtcctg
tacatgcttaagaatgtcagggtccttgggcactttgagaagcccctgttcctggagctg
tgcaagcacatgttctttgtgcagctgcacgagggcgagtacatcttccgtcccgggcag
ctggacgacagcatctatgtggtgcaggatggaaagctggaagtttgcatccaagaaagt
gatggaacggaggtggtggtgaaggaggtgctggcaggagacagcgtgcacagcctgctg
agcatcctggatgtcatcacgggtcaccctgctccctataaaaccgtctcggcccgagca
gcctctccatccaccatactgaggcttccagccagtgccttccaggatgtgttccagaaa
taccctgaaacccttgtcagagtggtgcagatcatcatggtgaggctgcagagggtgaca
ttcctggccttgcacaactacctggggctgaccacggagctcttcagctgtcagagccag
ggcacccctctgatctccgtgagcagcatcaccgctggagcgggcaaggcggggaggaga
cagacacccagtgctgtggaggaggagcgtggagagaagcttgaaaagtctggggaagcc
ctggaaatggacatgttgaggatttctggtgcagaaaactctgagcatgttttcagaaga
agcctttcatcacctccctatgcaggctctacagaggcttctaacaattccagcggtgcc
aagtctgacatggacatggcctacgagagggccagggtgcacctggctcccgaggacgcc
gccggcagccccagcgtggccaagtcgatactgaagaagacagtgacagtgacagaaact
ccttcagcagttttccattacagtgctgtgcaggactcctgtaacagcaaacacatcgat
gccattgtggaagcagcaaagaaagatctctcagccctgatgaaacttgataatcctgca
ttgctgaatggcaaagtgacattgcatcaggtcactgctggcactgtgctgtccaggcag
ggagatcaggatgtcaatgtttgctttgtggtctctgggatgctccatgtgtaccagagg
aagattgactctgaggaggacacctgccttttcatcacccaccctggggagctggtgggc
cagcttgctgtgctcactggggagcccctgatcttcaccatcaaggccaacagagactgc
agcttcctctccatctccaagtcccatttctatgagatcatgagggagcagcccagtgtg
gtgctgggggtggcccacagtgttgtcaggagaatgtccccctttgtcaggcagattgat
ttcgccctggactggatggaggtggaggctggacgagctgtttacaggcagggggacaag
tctgactgcacgtacatcgtgctgaacggccgcctgcgctccgtgctgcgcatggacgac
ggcaagaagcacctgaccggggagtacggccggggggacctcatcggagtggtggaggcc
ctgacccaccagcccagagccaccacggtgcacgcggtgcgggactcggagctggccaag
ctcccggagggggccctgatctccatcaaacgcaaattcccccaggttgtgaccagactt
attcacttgctgggcgagaagatccttggcagtctgcagcagggaggtcatcctctggga
ctgcacagctccagcagcaagtgggatgcagggaatcctgccagcaacctgtccacggtg
gcgatcatgccggtgtccgaggaggtgccgctgacagccttcaccctggagctcaagcac
gccctcagtgctgtgggtcctgccctgctgctcaccagtgacaacatcaaacagcgcctg
ggctctgctgctctcgacagcatccacgagtacagactgaccagctggctgggccagcag
gaggacatccacaggattgtgctgtaccaggctgacagcaccctgaccccctggacccag
cgctgcatccgccaggctgactgcatcctcatcgtggggctgggagaccaggagcccact
gtgggagagctggagaggatgctggagaacacagcagtgagagcccagaagcagctggtc
ctgctgcacaaggaggatgggcccctcccgtcccgcactgtggagtggctcaacatgagg
agctggtgttctgctcacctccacatccactgcccacgcagagtcttctccaaaaggagc
ctgcccaagctggtcgagatgtatgaacgcgtgttccagaaggctccagaccgtcactcc
gacttctcccgcctggcccgggtcctgacaggcaacgccatcgcgctggtgctgggcggc
ggaggggccaggggctgctcccaggtgggcgttatccgggcgctgatcgaggctgggatt
cccgtggacatgatcgggggcacgtccatcggctccttcatgagcgccctgtacgccgag
gagcgcagctacaaccagatgaggatcaaagctcgccagtgggccatggttatgaactca
gtgtttaggactattctagacctgacatacccaataacttctatgttttctggagcagct
tttaacaacagcatcaacaacatcttcaaagataagcagatagaggatctgtggattcct
tacttcaccatcaccactgacatcactgcctcagccatgagggtgcacagggatggctcc
ctgtggaggtacgtccgggccagcatgtccctctcggggtacatgccacccctgtgtgac
cccaaggatggccatctcctcatggatgggggctacatcaacaacctgccagctgacgtg
gccaggtccatgggggccaaggtggtgatcgccatcgacgtgggcagccgcgacgagacc
gacctgaccaactacggcgactgcctgagcggctggtggctgctctggaagaggtggaac
cccctggctgagaaagtcaaggtgctgaacatggccgagatccagacacgtctggcctac
gtgtgctgcgtgcggcagctggagatggtgaagaacagcgactactgcgagtacatccgg
ccccccatcgaccgctacggcaccctggactttggcaagttcgacgagatctgtgaagtg
ggataccagcatgggaaaactgtatttaatgtgtggtgcaggagtggagtccttgacaag
atgctgaaggacaggcaagagacctgcaaatccaaaactgataacgtgacctgtcccacc
acgtccttcacagacctggctgagattgtttcccgcatcgagcctgtcaaggctcctccg
ctggccgacgatgagtcagactaccagactgagtatgaggaagaagttctggacagccag
aaggatgattacctcgacttcagcaaccaggctgaggaagactctgactcggatgaggag
atgcagctgaggaagcgcaggaatgtgcccagcggggagggccagagcagcacgggagag
ccggggtag

DBGET integrated database retrieval system