KEGG   Serinus canaria (common canary): 103819576Help
Entry
103819576         CDS       T05755                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00500  Starch and sucrose metabolism
scan01100  Metabolic pathways
scan04910  Insulin signaling pathway
Module
scan_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103819576 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103819576 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scan01003]
    103819576 (GYS2)
Enzymes [BR:scan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103819576 (GYS2)
Glycosyltransferases [BR:scan01003]
 Polysaccharide
  Storage polysaccharide
   103819576 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103819576
NCBI-ProteinID: XP_009092347
LinkDB All DBs
Position
Unknown
AA seq 699 aa AA seqDB search
MPLARSMSMTSLNGLLQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWTMNHLVKLAVCFLCRGEIPDLNKILDRDD
ISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHPEFLSS
TSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVAD
PEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWKYLGRY
YMHARHLALSRTFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSASQHSSPHHSEAEDEDD
DERYDEDEEAERDRQNIKSPFSIGALPQGKKKQHGEYRN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgagatccatgtccatgacatctctgaatgggcttcttcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatggggt
gaaaactatttcctgattggcccctattttgaacagaatgtgaagactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgc
caggtcttttttggaagatggctgatagagggcagcccttatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagtcagcaacata
gggatcccttttcatgaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcccaatataattgcccacttc
cacgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaacttcccgtcgcc
acaatttttactacccatgcaactttgcttgggagatacttgtgtgcagccagtattgac
ttttacaacaatctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcgatactgcatggaacgggcgtctgtgcattgtgcccatgtgttcaccacagtctcc
cagatcacagctacagaagcagaacatatgcttaaaaaaagccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgaatttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagaccttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgat
gttacagttatcgtgttcttcatcatgccagcaaaaaccaacaatttcaatgtggaaacc
ttgaaaggacaagcagtccggaagcagctctggacaatgaatcatttggtaaaattggct
gtgtgtttcctctgcagaggagaaatcccagacctgaacaagattcttgaccgagacgac
ataagcattatgaaaagagccatcttttcaactcagagacactctctgcctccagtgacc
acccacaacatgattgatgacagcaatgacccaatcctgaacaccatccggcgcattggg
ctgttcaacaaccgcaccgaccgcgtgaaggtgatcctacatccagagtttctttcttca
acaagccccttgctgcccttggactatgaggagtttgttagaggctgccaccttggtgta
ttcccatcatactatgaaccctggggctacactccagctgagtgtactgtgatgggcatt
cccagtgtaaccacaaacctctctggattcggctgtttcatgcaggagcatgttgctgac
ccagaagcttatgggatctacattgtggacaggaggttccgctcaccagacgagtcgtgc
aaccagctgacccagttcctgtacggcttctgccagcagaaccggcgccagaggatcatc
cagaggaaccgcaccgagcgcctctccgacctcctggactggaagtacctgggcaggtat
tacatgcatgccagacacttggccctcagcagaacatttccagataaatttgagatggaa
ccaagtgctccaccaaagactgaaggtttcaggttccccaggccttcatcggtgccgccc
tcgccctctgcctcccagcattccagccctcaccacagcgaagctgaggatgaagatgat
gatgagagatacgacgaggatgaggaagctgaaagggataggcagaacatcaagtccccc
ttttccattggagccttgccacaaggaaagaagaagcagcacggagaatacaggaactga

DBGET integrated database retrieval system