KEGG   Serinus canaria (common canary): 103819614Help
Entry
103819614         CDS       T05755                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04012  ErbB signaling pathway
scan04068  FoxO signaling pathway
scan04150  mTOR signaling pathway
scan04270  Vascular smooth muscle contraction
scan04510  Focal adhesion
scan04810  Regulation of actin cytoskeleton
scan04910  Insulin signaling pathway
scan04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103819614 (BRAF)
   04012 ErbB signaling pathway
    103819614 (BRAF)
   04068 FoxO signaling pathway
    103819614 (BRAF)
   04150 mTOR signaling pathway
    103819614 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103819614 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103819614 (BRAF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103819614 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    103819614 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103819614 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103819614 (BRAF)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103819614 (BRAF)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103819614 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Motif
Other DBs
NCBI-GeneID: 103819614
NCBI-ProteinID: XP_018774213
LinkDB All DBs
Position
Unknown
AA seq 715 aa AA seqDB search
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVS
SSASTDTVASSSSSSLSVAPSSLSVYQNPADMSRNNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPPEEASLGETTPASGSYPSVPPSDSVGPPILPSPSPSKSIPIPQPLRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQSLRGEGGSAAGLSATPPASLPGSLTN
VKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVY
KGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWC
EGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKI
GDFGLATVKSRWSGSQQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTG
QLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILA
SIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgattaaattgacacaagaacatatagaagcactgctagacaaatttggaggagagcat
aacccaccttcaatatatttagaggcctatgaagagtacaccagcaagcttgatgctcta
cagcagagagaacagcagttactggaatccatggggaatggaactgatttctctgtctcc
agttcagcttcaacagacacagttgcatcatcttcctcctctagcctctctgtagcacct
tcatccctttcagtttatcaaaaccctgctgatatgtcacggaataaccctaagtctcca
cagaagcccattgttagagtcttcctgcccaacaagcaaaggactgtggttccagcaaga
tgtggagtgacagtccgagacagcctaaaaaaagcgctgatgatgagaggtcttattcca
gaatgctgtgctgtttacagaatacaagatggagagaagaagccaattggctgggacaca
gacatttcctggctcacaggagaggagttgcatgtggaagttttggagaatgtgccactc
acgacacacaatttcgtacgaaaaacgttcttcacattagcgttctgcgatttctgtcgg
aagctgcttttccaggggttccgctgccagacttgtggctacaaatttcaccagcgctgt
agtacagaagtgccactgatgtgtgttaattatgaccaacttgatttgctgtttgtctcc
aagttctttgaacatcaccccataccaccagaggaggcctccttaggagagaccacccca
gcatctggatcatacccttcagtgcccccctcagattctgttggaccaccaattctccct
agtccttctccttcaaaatccattccaatcccacagcccctccgaccagcagatgaagac
catcggaatcaatttgggcaacgcgaccgatcctcctcagctcccaacgtccacatcaat
acaatcgagccagtcaatattgatgacttgattagagaccagagtttacgaggagaggga
ggctcagctgcaggcttgtctgcaacacctcctgcttctttgcctgggtcactaaccaat
gtgaaagcattacagaaatcaccaggaccccaacgggaaaggaaatcatcctcatcctca
gaagacagaaatcgaatgaaaactcttggtcgacgggattcaagtgatgattgggagata
ccagatggacagatcacagttggacaaaggataggatctggatcatttggaacagtctac
aaaggaaagtggcatggtgatgtggcagtgaaaatgttgaatgttacggcacctacacct
caacagttacaggctttcaaaaacgaagtaggagtgctcaggaaaacacgacatgtgaat
atcctgcttttcatgggttattcaacaaaaccccagttggctattgttacacaatggtgt
gaagggtccagtttgtatcaccatctacacatcattgagaccaaatttgaaatgatcaag
ctaattgatattgcacgacagactgcacaaggcatggattatttgcatgccaagtcaatc
atccacagagacctcaagagtaataatatttttcttcatgaagacctcacagtaaaaata
ggtgattttggtctagctacagtgaaatcacggtggagtggatcccaacagtttgaacag
ttgtctggttccattctatggatggcaccagaagttattaggatgcaagataaaaaccca
tatagttttcagtcggatgtgtatgcatttgggattgttctctatgaattgatgactgga
cagttgccatactccaacatcaacaacagggaccagataattttcatggtgggacgagga
tacctatctccagacctcagcaaagtgcggagcaactgtcccaaagctatgaagagacta
atggcagaatgcttaaaaaagaaaagagatgagagacccctttttccacagatccttgcc
tccattgagctcctggcccggtcattgccaaaaattcaccgcagtgcatctgagccctcg
ttgaaccgggctggcttccagacagaggattttagtctatatgcttgtgcttctccaaaa
acacccatccaggcagggggatacggagaatttgcagcgttcaagtag

DBGET integrated database retrieval system