KEGG   Serinus canaria (common canary): 103819664
Entry
103819664         CDS       T05755                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
scan  Serinus canaria (common canary)
Pathway
scan04012  ErbB signaling pathway
scan04068  FoxO signaling pathway
scan04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103819664 (CDKN1B)
   04068 FoxO signaling pathway
    103819664 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103819664 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103819664
NCBI-ProteinID: XP_009092454
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNREFKKHLQEMGEAYQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTAQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccttggagcgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgccggaacctcttcgggccggtgaaccacgaagag
ctcaacagggaatttaagaaacacctgcaggagatgggggaggcgtaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagacccccccggctacggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgcccagaggaaaagacccgcggccgatgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacgcccaagaaatcaagcccgggaagacatcaaacgtaa

DBGET integrated database retrieval system