KEGG   Serinus canaria (common canary): 103820198
Entry
103820198         CDS       T05755                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00220  Arginine biosynthesis
scan00330  Arginine and proline metabolism
scan01100  Metabolic pathways
scan04020  Calcium signaling pathway
scan04146  Peroxisome
scan04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103820198 (NOS2)
   00330 Arginine and proline metabolism
    103820198 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103820198 (NOS2)
   04020 Calcium signaling pathway
    103820198 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103820198 (NOS2)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103820198 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103820198
NCBI-ProteinID: XP_009093091
LinkDB
Position
Unknown
AA seq 1147 aa
MLCPWQFVFKSRAARSQYPREKDINNNVEKNRKIHGSEEDDAKLHNPSKKQMERLPILTS
ANPCEGGENLPPNDIKVSNQISGCPRHVRVRNLENGSSFLDTLHLTAKQVISCQTKACQG
SLMTPKGLVRGPRDGPVPLEDLLPQARDFLKQYYSSFKEPKTKEQLGRLEAVTKEIETTG
TYHLTKDELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICHHIQYATNN
GNIRSAITVFPPRTDGQHDFRVWNSQLIHYAGYHMPDGSVLGDPATVEFTQLCIELGWKP
KYGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWFKELELKWYALPAVASMLL
EVGGLEFTACPFNGWYMGTEIGVRDFCDTQRYNVLKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRARGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPRKKEIKFSILAKAVLFASSLMRGAVATRA
KVTVIYATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLEKETLLLVVTSTFGNGD
SPGNGKALKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLTQLGASQLTPVG
EGDELNGQEEAFCSWAVSAFKAACDIFNVRGRHSIQLPKIYTSEESWDPTNYRVVHDSQP
MDLAKALANIHAKDVIPMKLKFRQNLQSSRSSRVTILVKLHCETNQEVHYLPGEHIGIFP
GNQAELVQGIIARVKDAPPADQTIRLETCIDGGYWARNKKIPACTLPEALTYLLDITTPP
SQQLLKKLSRLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNLLEVLEEFSSAEVSTAFLL
TQLPLLKPRYYSVSSSCDMTAKEIHLTVAVVNYRTRDGEGPLHHGVCSTWLNTIELNETV
PCFIRSANEFHLPEEPAKPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGGDMTLLFGCR
QPDLDHIYREETEEMKRRGVLRDVYTAYSRLPGQKKVYVQDILQEQLEARVCEVLHGQQG
HVYVCGDVRMARDVAAALRALLARALRLSQQQANEYFQQLKSQKRYHEDIFGAVFPHEVK
RALQPTS
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgctgtgcccgtggcagtttgtgttcaaatctcgtgctgccaggagccagtaccccaga
gagaaggatatcaacaacaacgtggagaaaaataggaagatccatggctcagaagaggat
gatgccaaattgcacaatcccagcaagaagcagatggagaggctgcctatcctaacttca
gcaaacccctgtgagggaggagagaatctccctccaaatgacatcaaagtttcaaaccaa
atatctggatgtccaagacatgtaagagtaagaaacttggaaaatggatccagctttctt
gacacactacacctgactgcaaaacaggtgatcagttgccagaccaaagcctgccaaggg
tcactcatgaccccaaagggcctggtgagaggtcccagagatgggccagttccactagag
gatcttttacctcaggcaagagacttcctcaagcaatattacagttcatttaaagagcca
aaaaccaaagaacagctgggccggctggaagcagtgaccaaggagatagaaacgacggga
acctaccacctgacaaaggatgagctgacctttgctgccaagcaggcctggaggaatgca
cccaggtgcatcgggagaatccagtggtccaacctgcaggtgtttgatgcacgggactgt
aaaacagccaaggaaatgtttgagcatatctgtcatcatattcagtatgccacaaacaat
ggtaatataagatcagccatcacggtgttcccgcccaggacggacgggcagcacgatttc
cgcgtgtggaacagccagctgatccactacgctggctaccacatgccagatggctctgtc
cttggagaccctgccactgtggagttcactcagttgtgcatcgagcttgggtggaagccg
aaatatggccgctttgatgtacttccacttgttctccaagcaaatggccaagacccagaa
atatttgaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgag
tggtttaaggagctggagctgaagtggtacgcgctgcctgcagtggccagcatgctgctg
gaggtgggagggctggagttcaccgcgtgccctttcaatggctggtacatgggcaccgag
atcggagtgcgcgacttctgcgacacgcagcgctacaacgtcctgaaggaggtagggagg
agaatgggactggaaacaaacaaactgtcatcattatggaaggaccgagctgttgtagag
atcaatgtggctgtgcttcacagcttccagaaacagaatgtgaccatcatggatcaccac
tcggcctccgagtccttcctgaagtacatgcagagcgagtaccgcgcgcggggcggctgc
cccgctgactgggtgtggattgtgcctcccatgtcaggcagcataacccccgtgttccac
caagagatgttgaactatgttctcactcccttctattactaccaggtggatgcatggaaa
actcatgtgtggcatgatgagacccggaggccgaggaaaaaagaaataaagtttagcatc
ttggcaaaggctgtgctctttgcatcctcgctcatgcgaggggcagtggccaccagggcc
aaggtcaccgtgatctacgcgacagagacgggcaagtcagagacactcgccaacaacctg
tgcagcctgttcagctgtgccttcagcaccaagatcctgtgcatggatgagtacaatatt
tgtgacctggaaaaagaaacacttcttttagtggttactagcacttttggaaatggagat
tctccaggtaatggaaaggccttgaaggactccttgctcagactgaaactgctgagaaat
aaaattaggtatgctgtgtttggtctggggtccagcatgtacccagaattctgtgccttt
gctcatgccattgaccaaaaactgacccaactcggggcttcccagctcactccagtgggt
gaaggggatgagctcaatgggcaagaagaagctttctgcagctgggcagtcagtgctttc
aaggctgcctgtgacatttttaatgtccgtgggagacacagtattcagctacctaagatc
tacacctctgaggaaagctgggaccctaccaattacagagtagtgcatgactcccagccc
atggacctggctaaagctcttgcaaacattcatgccaaggatgtaattcccatgaagctg
aaattcaggcagaatcttcaaagttcgaggtccagtcgtgtcaccattctggttaaactt
cactgtgagactaaccaggaagtgcactaccttcctggggagcacattgggattttccca
ggcaaccaggcagaattagtccaaggcatcattgcacgtgtcaaggatgcccctccagct
gatcagactatcaggcttgaaacctgcattgatggtgggtactgggcaagaaacaaaaag
attccagcctgcacactacccgaggctttgacatacttgcttgatatcactactccaccc
tcccaacaactgctaaaaaaactctcccggctggtgacagcagaaggagacaagcagagg
ctggaggtgctgtgtcagagcacagaggaatacaacaaatggaagttttacaacagcccg
aacctcctggaggtcctggaggaattctcctctgctgaggtctccacagctttcttgctg
actcagctgccactgctgaagcccaggtactattctgtcagctcctcctgtgacatgaca
gccaaagagattcatctgacagttgcagttgtaaactacaggacaagagatggagaaggg
cctttgcaccatggagtctgcagcacatggctgaacacaatagagctcaatgaaaccgtt
ccctgcttcatccgcagtgctaacgagttccacctcccagaggagccagccaagccctgc
attctgatcggctcgggcacgggcattgctcccttcaggagcttctggctgcagcgcctc
tatgacctggagcacagagggctcagaggaggggacatgaccttgctgttcggctgccgg
cagccagacctggatcacatctacagggaggagactgaggagatgaagaggaggggagtc
ctgagagatgtctacacagcttactccagactgcctggccaaaagaaagtctatgtccag
gacatcctgcaggaacagctggaggcccgcgtgtgcgaggtgctgcacgggcagcagggc
cacgtgtacgtgtgcggggatgtgcgcatggcgcgggacgtggccgcggcgctgcgggcg
ctgctcgcccgggccctgcgcctcagccagcagcaggccaacgagtacttccagcagctc
aagagccaaaagcgataccatgaagatatatttggggctgtgttcccacatgaagtcaaa
agagctttgcaacccaccagctga

DBGET integrated database retrieval system