KEGG   Serinus canaria (common canary): 103820462
Entry
103820462         CDS       T05755                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04020  Calcium signaling pathway
scan04260  Cardiac muscle contraction
scan04261  Adrenergic signaling in cardiomyocytes
scan04270  Vascular smooth muscle contraction
scan04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103820462 (CACNA1C)
   04020 Calcium signaling pathway
    103820462 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103820462 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103820462 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103820462 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103820462 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:scan04040]
    103820462 (CACNA1C)
Ion channels [BR:scan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103820462 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 103820462
NCBI-ProteinID: XP_018775331
LinkDB
Position
Unknown
AA seq 2175 aa
MFQALVRQAYHPLPSHQPGEPDAKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGADMEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMEKTAVEEETKEEKIELKSITAD
GESPPATKINVDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQI
LFYFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAIN
VVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFK
GKLYSCTDSSKQTEAECRGYFITYKDGEVSQPMIQPRSWENSKFDFDNVLTAMMALFTVS
TFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQ
GEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLN
TICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQ
FAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHV
SYYQSDGRSGFPQTFTTQRPLHINKSGNNHGDTESPSHEKLVDSTFTPSSYSSSGSNANI
NNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEAPWKLPSKRTHYYETLARSSS
RDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPEHSKGE
DTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSP
LLQRSHSPTMFSRLCATPPATPCNRGWPQQSIPTLRLDGADSSEKLNSSLPSVHCGSRYP
ESGGSPRRARPVSLTVPSPTAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQE
LADACDMTIEEMENAADNILNGNSKQSPNGNLLPFANCRDPGQDSAGEEEEEVQNPDCRI
SQEELKDSRIYISSL
NT seq 6528 nt   +upstreamnt  +downstreamnt
atgtttcaagccttggttcggcaagcgtatcaccccctgcccagccatcagccgggggaa
cccgacgccaagtacaaggggaagctggtgcatgaaactcagctgaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcacatccccacgccgggggcagctctgtcctggcag
gctgccatcgatgctgccaggcaagccaagctgatgggcagtgctggcaacgccaccatc
tccacggccagctccacgcagaggaaacggcagcagtatggcaagcagaagaagcagggc
accaccacagccacccgtcctccccgggcactgctgtgcctcacgctgaagaatcccatc
cggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatacggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggattcgatgtt
aaagcactgcgggctttccgagtattacgtccactacggctggtgtctggagtccctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcattattatctatgccatcattggactggagttattcatggggaag
atgcataagacctgctaccatgtgcaagggggactgatagatacacctgcagaagatgat
ccatccccgtgtgccccccagtctgcccacgggcggcagtgtcagaacggcaccgagtgc
aaggcgggctgggagggacccaagcatggcattaccaactttgacaattttgcttttgcc
atgctcaccgtgtttcagtgcatcaccatggagggctggacagatgtgctctactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggagttttccaaagaaaga
gaaaaggccaaggctcgaggcgatttccagaagcttcgggaaaagcagcagctagaggag
gatctgaagggatacttagactggataactcaagcagaagatattgatccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagtgagaccgag
tccgtgaacaccgacaacgtccccggcgcagacatggaaggcgagaactgcggcgcgagg
ctggcgcatcggatctcaaaatcaaaatttagtcgctactggcgccgatggaatcgattc
tgcagaaggaagtgccgtgctgctgtcaagtccaatgttttctattggctggtgatcttc
ctcgtgtttctcaacaccctcaccattgcctctgagcactacaaccagccagactggctc
acggaggtccaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagccttgggctccaggcctactttgtgtccctcttcaaccgctttgac
tgtttcattgtgtgtggaggcatcctggaaaccatcctggtggagacaaagatcatgtca
cccctgggcatttcggtcttgagatgtgtgagactcctcagaatatttaaaatcacaaga
tattggaactccctgagtaatcttgtggcttcgctcctgaattcagtccgctccattgcc
tccctgttgctgcttctcttcctcttcatcatcatcttctcactcctggggatgcagctc
tttgggggcaagtttaactttgatgagatgcagaccaggaggagtacatttgacaacttc
cctcagtccctcctgactgtgtttcagatcctgactggggaggactggaattcggtgatg
tatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttac
ttcatcatcctcttcatctgtggaaactatatcctgctgaatgtatttttggccattgct
gtggacaaccttgctgatgctgagagtttaacatctgcacagaaagaggaggaagaggaa
aaagaaaggaaaaagttagctaggactgctagtcccgaaaagaaacaggagatggagaaa
acagctgtggaggaagagacaaaggaggagaaaattgagctgaaatcgatcactgctgat
ggagagtccccacctgctaccaagatcaacgtggatgattatcagcccaatgaaaatgaa
gaaaagagcccttatcccacaacagaagcaccagcagaggaagatgaggaagaacctgag
atgcctgtcggccctcgacctcgcccgatgtctgagctgcacctcaaggaaaaggctgtg
cccatgcctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtgcac
tgccatcgcatcgttaacgataacattttcaccaacctgatcctgttcttcatcttgctc
agcagcatctccctggcagctgaggaccccgtgagacacctctcctttaggaaccaaatt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatg
actgcctacggggctttcctccacaagggctccttctgcaggaactatttcaacatcttg
gacctgctggtggtcagcgtttctctcatctcctttgggatccagtccagtgccatcaac
gtggtgaagatccttcgtgttctgcgggtcctcaggccactgagggccatcaacagagcc
aaaggactaaagcacgtggtgcagtgcgtgtttgtcgccatccgaaccattgggaacatt
gtgattgtcaccactttgctgcagttcatgtttgcctgcattggagttcagctgtttaag
ggcaagctgtacagctgcactgacagctccaagcagacagaagcagagtgcagagggtac
ttcatcacctacaaggatggggaggtcagccagcccatgatacagccccgcagctgggag
aacagcaagtttgacttcgacaacgtcctgactgccatgatggccctcttcactgtctcc
acctttgagggctggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatctccatcttctttattatctacatcatcatc
attgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaa
ggagaacaagagtacaagaactgtgagctggacaaaaaccagcgccagtgtgtagagtat
gccctgaaagcccggcccctgcggagatacatccctaaaaaccagtaccagtacaaagtt
tggtatgtggtcaactccacctattttgaatacctgatgttcgttctgatcctgctgaac
accatctgcctggccatgcaacactatggtcagagctgcatgttcaaggaagccatgaac
atcctcaacatgctcttcactgggctcttcactgtggagatggtcctgaaattaattgcc
ttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctct
tcctctatgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgc
gtgatgcgcctcgtgaagctcctgagccgaggggagggcatccggacactgctttggacc
ttcatcaagtccttccaggctctcccctatgtggctcttttgatagtgatgttgttcttc
atctacgctgtgattgggatgcaggtgtttggtaaaattgcgctgaacgacaccacagaa
atcaaccgcaacaataacttccagaccttcccccaggcagtgctgctgcttttcaggtgt
gccacaggtgaggcctggcaggaaatcatgctggcatgtctcccagacaagaagtgtgac
ccggagtcggagccggccaactccacggaagccgatcactcgtgcggcagcagcttcgcc
gtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaatctttttgta
gctgtgataatggataactttgattacctgacacgggactggtccattttaggaccacac
cacctggatgagtttaaaaggatctgggcagagtatgaccctgaagctaagggacggatc
aaacacctggacgtggtgacgctgctgcggcggatccagcccccgctgggcttcgggaag
ctctgccctcaccgggtggcttgcaaacgccttgtctccatgaatatgccactgaacagc
gatgggaccgtcatgttcaatgccactctctttgcactggtcagaacagcactgaggatc
aagacagaaggtaacctggagcaagccaatgaagagctgagagcaataattaagaaaatc
tggaagcgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggtgatgatgag
gtgaccgtggggaagttctacgccactttcctgatccaggagtatttcaggaagttcaag
aagcgcaaagagcaggggctggtggggaagccctcccagcgcaacgcgctctccttacag
tttgctgttttgcaggctgggctgcgcacactgcacgacatcgggcccgagatccgacga
gccatttctggggacctgacagctgaagaggagctggacaaggccatgaaagaagctgtt
tctgctgcctctgaagatgacatcttccggagagctggaggcttgtttggaaaccatgtg
agctactaccaaagtgatggcaggagtgggttcccccagacattcaccacccagagacct
ttgcacatcaacaagtctggcaacaaccacggcgataccgagtctccatctcacgagaag
ctggtggactccaccttcactcccagcagctactcatcttcaggctccaatgccaacatc
aacaatgccaacaacactgccctgtgtcgcttccccagcccacccagctaccccagcact
gtcagcacggtggaaggccacgggacccccttgtcacccaccatatgtgtgcaggaggct
ccctggaagctcccctccaaaaggacacattactacgagacactggcacgctccagttcc
agagacagccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgat
gaaaatttgaatgaagacattgagtactgtagtgaaccaagcctgctctctaccgaaatg
cttgcataccaagatgatgaaaacagacaactcactccaccagagcacagcaaaggagag
gacacccggcactctccaaagaaggggttcctgtgctcctcagctctaggtcgaagagca
tcttttcacttagagtgtttgaaaagacagaaaaaccagggtgtggatgtctcacagaag
acagtcctgcctttgcatctggtccatcatcaggcactagcagtggccggcctgagtccc
ctgctccagagaagccattcccccaccatgttctctcggctgtgtgctacgcccccggcc
acgccctgcaaccggggctggccgcaacagagcatcccaacgctgcgcctcgacggggcg
gactcctcggagaagctcaacagcagcttgccgtccgtgcactgcggctcccggtacccg
gagagcggcggcagccccaggagagctcgacccgtgtccctgaccgtgcccagccccacc
gcagggagcagccggcagttccacggcagcgccagcagcctggtggaagcggtcttgatt
tcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacaacccaggag
ctcgcagacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctcttgccttttgctaactgcagggac
ccagggcaggacagtgcaggagaggaagaggaagaggtgcagaacccggattgtaggata
agtcaggaggagctcaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system