KEGG   Serinus canaria (common canary): 103820784Help
Entry
103820784         CDS       T05755                                 

Gene name
H6PD
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00030  Pentose phosphate pathway
scan01100  Metabolic pathways
scan01200  Carbon metabolism
Module
scan_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
scan_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    103820784 (H6PD)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     103820784 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     103820784 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 103820784
NCBI-ProteinID: XP_018775887
LinkDB All DBs
Position
Unknown
AA seq 790 aa AA seqDB search
MLGRVLCTVLFVGALPSPAGASQGHISVILLGATGDLAKKYLWQGLFQLYMDQVSSGHSF
TFHGAALAALEPGQRLMFDVLKKLSCPPDEAPNRCAVLKDQFLKLSQYHQLKTAENYSAL
NREIETLLRQEGLEEAGRIFYFSVPPFAYTEIAGHINGSCRPRAGAWLRVVLEKPFGHDL
PSAQQLAAQLAGFFREEEMYRVDHYLGKQAVAHILPFRDQNRQFLDPIWNWHHVERVEVV
LKETVDAKGRTSFYEQYGVIRDVLQNHLTEALMFLIMELPANVSSAQEVVQHKLQAFQAL
WGLQRSSAVLGQYQAYDSQVQEELPEARGYVSTTPTFAGVLIHSHSPRWEGVPFLLTSGK
ALDERVGYARVLFRNRAYCPQSGTLRDAGHSQCKPKQIIFYFGHGALNTPAVLVSRNLFQ
PVMPKDSWKEAGARSDLHIFGQPLSDFYMYSPVKERDAYSVLISHIYHGRKDFFITTENL
LASWAFWTPLLDSTSRQPPRLYPGGVENQQLLDFEMVAEGVAFTLAEPAELLNPSGQMPS
DFRAIQSKFRQSPLVSAWAEELIARLASDMEEAALRSVARSGQFHLALSGGSSPVGLFQR
LARHHHGFPWQHSHVWLVDERCVPLTDGESNFQGLHRHLLRHVRVPYLNIHPMPVHLNRR
LCVEEDGGAQLYAKDIVALVANASFDLVLLGVGTDGHTASLFPRSEQGLEGAPTVVLTES
PVKPHQRMSLSLPLINRARQVFVLVLGKGKHDITTLLSRVGREPSKWPISGVSPSSGQLV
WYVDYEALLG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaagggtcctgtgcacggtgctgttcgtgggagccctcccatccccagctgga
gcctcccagggccacatctccgtgatcctgctgggagccacgggggatttggccaagaag
tatttgtggcagggcctgttccagctctacatggaccaagtgagcagtggccacagcttc
acattccacggggctgccctggcagctctggagccggggcagaggctgatgtttgacgtg
ctgaagaagctgtcctgcccccccgacgaggctcccaacaggtgtgccgtgctcaaggac
cagttcctgaagctgagccagtaccaccagctgaagactgctgagaactactcggctctg
aacagagagatcgagaccctgctccgccaggaggggctggaggaggctggcaggatcttc
tacttctccgtgccaccctttgcctacacggagatcgcggggcacatcaacggcagctgc
cggccgcgcgccggggcctggctgcgcgtggtgctggagaagccctttggccacgacctg
ccctcggcccagcagctggctgcacagctggcaggcttcttcagggaggaggagatgtac
cgtgtggaccattacctgggcaagcaggctgtggcccatatcctgccttttcgggatcag
aaccgacagtttctggaccccatttggaactggcatcatgtggaaagagtggaggttgtc
ttgaaggagactgtggatgctaaagggcgcaccagcttctacgagcagtacggggtgatc
cgggacgtgctgcagaaccacctgaccgaggccctcatgttcctcatcatggagctccct
gccaacgtcagcagtgcccaggaggtggtgcagcacaagctgcaggccttccaggccctg
tgggggctgcagaggagcagcgccgtgctgggccagtaccaggcctacgacagccaggtg
caggaggagctgcccgaggcacggggctacgtcagcaccacgccaacctttgcaggagtg
ctgatccacagccacagcccgcgctgggaaggggtccccttcctgctcacctcggggaag
gctctggatgagcgggtgggttacgcccgcgtcctcttcaggaacagggcctactgccct
cagagtggcacgctgagggatgcagggcacagccagtgtaaacccaagcagatcatcttc
tacttcgggcacggtgctctcaacacccctgcggtgctggtgagcaggaacctcttccag
cctgtcatgcccaaggacagctggaaggaagcgggggctcgctcagacctgcacatcttc
ggacagccgctgtctgatttctacatgtacagccctgtgaaggagagggatgcctattct
gtcctcatctcccacatctaccacggcaggaaggatttcttcatcaccacggagaacctg
ctggcctcctgggccttctggacccctctgctggacagcacgtcccgccagcccccgcgc
ctctaccccggtggcgtggagaaccagcagctgctggactttgagatggtggccgaggga
gtggcgttcaccctggcagagccggcggagctgctgaaccccagcgggcagatgccgagt
gacttcagggccatccagtccaagttccggcagagtcccctggtgtcggcctgggccgag
gagctgatcgcccggctggcctccgacatggaggaggcggccctgcgcagcgtggctcgc
tcgggccagttccacctggccctgtcgggcggctccagccccgtggggctgttccagcgc
ctggccaggcaccaccacggcttcccctggcagcacagccacgtgtggctggtggacgag
cgctgcgtgccgctgaccgacggcgagtccaacttccagggcctgcaccggcacctcctg
cggcacgtcagggtgccctacctcaacatccaccccatgcccgtgcacctcaaccgccgc
ctctgcgtggaggaggacggcggcgcccagctctacgccaaggacatcgtggccctggtg
gccaacgccagcttcgacctggtgctgctgggggtgggcacggacgggcacacggcctcg
ctcttcccccgctccgagcagggcctggagggggcccccaccgtggtgctgaccgagagc
cccgtcaagcctcaccagaggatgagcctcagcctgcccctcatcaacagggccaggcag
gtgttcgtgctggttctgggcaagggcaagcacgacatcaccacgctgctcagcagggtg
ggccgcgagcccagcaagtggcccatctcaggggtcagccccagctctggccagctggtc
tggtacgtggattatgaagctctgctggggtga

DBGET integrated database retrieval system