KEGG   Serinus canaria (common canary): 103820856Help
Entry
103820856         CDS       T05755                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X2
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04012  ErbB signaling pathway
scan04136  Autophagy - other
scan04140  Autophagy - animal
scan04150  mTOR signaling pathway
scan04218  Cellular senescence
scan04371  Apelin signaling pathway
scan04910  Insulin signaling pathway
scan04920  Adipocytokine signaling pathway
scan05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103820856 (MTOR)
   04371 Apelin signaling pathway
    103820856 (MTOR)
   04150 mTOR signaling pathway
    103820856 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103820856 (MTOR)
   04136 Autophagy - other
    103820856 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    103820856 (MTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103820856 (MTOR)
   04920 Adipocytokine signaling pathway
    103820856 (MTOR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103820856 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103820856 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:scan04131]
    103820856 (MTOR)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103820856 (MTOR)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103820856 (MTOR)
Membrane trafficking [BR:scan04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    103820856 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD UME HEAT_EZ EPSP_synthase CFIA_Pcf11
Motif
Other DBs
NCBI-GeneID: 103820856
NCBI-ProteinID: XP_009093881
LinkDB All DBs
Position
Unknown
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYSAHQGIMGFATSPVPVKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQGRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETSATGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSTSQSVEMLDSVELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtactgtgtccattctccagcagtttgccaatggcttgaagagtcgcagcgaa
gagacaagggccaaagctgccaaggacttgcagcactatgtcaccatggagctgcgtgag
atgagtcaggaagaatctaccaggttttatgatcagctgaaccatcacatatttgagctg
gtctctagctctgatgcaaatgaaaggaagggtggcattctggctatagcaagtcttatc
ggtgttgaaggaggtaatgccacccgtatcggcaggtttgccaactacctgaggaacctc
ctgccatccaatgaccctgttgtgatggagatggcttccaaggctattgggaggcttgca
atggctggtgacaccttcacagctgagtatgtggagtttgaggtgaaacgagctctggag
tggctgggagctgacaggaacgaaggtcgtagacatgcagctgtccttgtcttgcgggag
ctggcaatcagcgtgcctaccttcttcttccaacaagtgcagccattctttgacaatata
tttgtggctgtgtgggatcccaagcaggccatccgagagggagctgtctctgccttaaga
gcctgccttatcctcaccacgcaacgggagccaaaagagatgcagaagccccagtggtac
agacatacatatgaagaggctgagaagggctttgatgagactttggccaaagagaaagga
atgaatcgtgatgaccgaatccacggtgccttactgatcctcaatgagctagtgagaatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctt
gtgcatgacaagtactgcaaagacctcatgggcttcagtaccaagcctcgccacatcact
cccttcacaagctttcagtctcttcagccctctcagtcaaatgccttggctggtctcctg
gggtacagtgctcaccaaggaattatgggttttgcaacctcacctgtcccagtaaaatct
actctggtagaaagtcgatgctgcagggatctaatggaagagaagtttgatcaagtctgc
cagtgggttctcaagtgcagaaccagcaaaaattctttgatccagatgacagttctcaat
ctgctaccacgactggctgctttccgtccttcagcattcacagctgatcagtatcttcca
gacaccatgaatcatgttctcagttgtgtgaagaaggagaaggagcgaacagcagccttc
caggccttgggtttgctttctgtggcagtgaggtctgagtttcaagcttacctaccaaaa
gtccttgaaatcataaaagcagctcttcccccaaaggactttgcccacaagagacagaag
tctgtgcaggttgatgctacagttttcacctgcattagtatgctggcacgagccatggga
cccagtatccagcaggacatcaaagagcttttggaacctatgctggctgtgggcctgagc
cctgctctaacagctgtgctgtacgacctgagccgtcagatcccacagctgaagaaggat
atccaggatgggctgctgaaaatgctctctcttgttctgatgcacaagcctctgcgacat
ccaggcatgccaaagggccttgcccaccagctggcctcccccagtctcaccaacatccca
gaggccagtgatgtggggagcatcacccttgccctgcgcacgctcggtagctttgagttt
gaaggccactccctgactcagttcgttcggcattgcgcagatcacttcctgaacagtgag
cacaaggagatccgcatggaagccgcccgcacctgctctcgcctgctcacaccctccatc
cacttgatcagtggccatgcccatgtggtcagtcagacagcagtgcaggtcgtggctgat
gtcctcagcaaactgcttgtggttggaataactgacccagaccctgatatacgtttctgc
gtgttggcttctctggatgagcggtttgatgctcaccttgcccaggctgaaaacctgcaa
gctctttttgtggccctgaatgatcaagtgtttgaaatccgagagctggccatctgcacc
gtggggcgcctgagcagcatgaaccctgcctttgtcatgcctttccttcgcaagatgtta
atccagattctaacagagctggaacacagtggtgttggcagaatcaaagagcaaagtgcc
agaatgttgggtcacctggtttccaatgctccacgcctcatccgtccctacatggagcct
attcttaaggcactgattgtgaaactgaaagatcctgatccagatcccaatccaggcgtg
attaacaatgtcctagctacaataggggagcttgcacaggtcagtgggctggagatgagg
aagtgggtggatgagctcttcattataattatggacatgctgcaggactcctcccttctg
gctaaaagacaagtggctctttggacactggggcagctcgtggctagcactggttacgtg
gtagagccatacaggaagtacccaactctgctggaggtgctcctgaacttcctgaagact
gagcaaaaccagggcacccgcagagaggctattcgtgtgctagggctgctgggtgctttg
gacccttacaaacacaaagtgaacattggcatgattgatcagtcacgagatgcttcagct
gttagcctctcggagtccaaatccagccaggattcttctgactacagcaccagtgagatg
ttggtgaacatgggcaacctccctctggatgagttctatccagctgtctccatggtggca
ctgatgagaatcttccgagaccaatccttgtcccaacaccacactatggtagttcaggcc
atcacctttattttcaaatctcttggactgaagtgtgtgcagttcctgccccaggtgatg
ccaacgttcctgaacgtgatccgggtgtgtgacggtgccatccgagagttcctgttccag
cagctgggaatgttggtgtcctttgtgagaagtcatattcggccctatatggatgaaatt
gtcaccttgatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttattgagcagattgtggtagctctaggaggtgaattcaaactttacctgcctcagctc
atccctcacatgttacgggtcttcatgcacgacaacagtcagggtcgcattgtttctgtg
aagcttcttaatgcaatccagctctttggagctaacctggatgactaccttcacttgtta
ctacctcccattgtaaagctatttgatgccccagatgtccctgtggtggctcgcaaagct
gctctagaaacagtggaccggctgacagagtccctggatttcacggattatgcgtcacgg
attattcaccccatcgtacgaacactagatcagagccctgagctcagaacaactgcaatg
gacaccctctcctctctggtgttccagctgggaaagaagtaccaaatttttatcccaatg
gtgaacaaagtcctggtgcgacacagaattaaccatcaacgctatgatgttctcatctgc
aggattgtcaagggttacactcttgctgatgaagaggaggatcccctgatttatcagcat
cgaatgttgagaagcaaccagggagaaacttcagccactggtcctgtggaaacaggtccc
atgaagaaattacatgtgagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtttccaaggatgactggttggaatggttaaggagactgagtttggagctgctgaaagat
tcttcctcaccatccctgcgctcatgttgggccctggctcaggcctataatcccatggct
cgagacctcttcaatgctgcctttgtttcatgctggtctgaactgaatgaagaccagcag
gatgagctgatccgaagcattgagttggccttgacttctcaggacattgcagaagtcact
cagaccctactgaacttggcagaattcatggagcacagtgacaagggccccctgcctttg
agggatgacaatggcattgtccttctgggggaaagagctgccaaatgtcgagcatatgct
aaggcccttcactacaaagagctggaatttcaaaagggccccaccccagctattctggag
tctcttatcagcattaacaataaactccaacagccagaagcagctgctggtgtgctggag
tatgccatgaagcactttggggagctggaaattcaagctacctggtatgaaaagcttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaggatgatcct
gagctgatgctgggacgcatgcgttgcttggaagcccttggtgaatgggggcaactccac
cagcagtgctgtgaaaagtggacccaggtgaatgatgagactcaagctaagatggccagg
atggctgctgctgctgcttggggcctgggtcagtgggacagcatggaggaatacacctgc
atgatccccagggacacccatgatggtgctttctacagggctgtgctggcactgcatcag
gaccttttctcactggctcagcaatgcattgacaaagccagagacctgctggatgctgag
ctgactgccatggcaggagagagctacagcagagcctatggggctatggtgtcctgccag
atgctgtcagagctggaagaggttatccagtacaaacttgtcccagagcgccgtgagatc
atccgccagatctggtgggaaaggctgcagggctgtcagcgaatcgtggaagactggcag
agaatattgatggtccgatctcttgttgtgaatcctcatgaggacatgagaacttggctc
aagtatgccagcttgtgtggcaagagtgggaggctggctttggcccacaagacccttgtc
ctgctcctgggagtagatccctctcgacagctggatcacccactgcccacagtgcacccc
caagtgacctatgcctacatgaagcacatgtggaagagtgcccggaagattgatgcattc
cagcacatgcagcactttgtgcagaccatgcagcagcaggcccagcacgccatcgccacc
gaggaccagcagcacaaacaggagctccacaagctcatggcacggtgtttcctgaagctg
ggtgagtggcagctgaacctgcaaggcatcaatgagagcaccatccccaaagtcttgcaa
tactacagtgctgcaacggagcatgatcgcaactggtacaaggcctggcatgcctgggca
gtgatgaactttgaagcagtgcttcactataaacatcaaaaccaggccagagatgagaag
aagaaactccgtcacgcgagcggagccagcatcaccagcgccaacactgagggcagcaac
agtgagagtgatgcagagagcactgagaacagtcccatcccatccccagtgcagaaaaaa
gtcactgaggatttatccaagaccctcttgatgtacacagtccctgctgtccagggtttc
ttccgatccatttctctgtctcgaggaaacaacctccaagacactctaagagtccttact
ctgtggtttgactatggtcattggcctgatgtgaatgaggctttggtagaaggagtcaag
gcaatccaaatagacacttggctgcaggtgatcccccagctcatagccaggattgacacc
cctcgcccgctggtgggccggctcatccaccagctgctcacggacatcgggcgctaccac
ccgcaggctttgatctatcctttgactgtggcttccaaatctacgaccactgctcggcac
aatgctgcaaataagatcttgaaaaacatgtgtgagcatagcaacactctggtgcagcag
gcaatgatggtgagtgaagagctgattcgtgtggccatcctgtggcatgagatgtggcat
gaagggttggaagaagcatctcgtctgtattttggagaaagaaatgtaaagggaatgttt
gaggtgctggaaccacttcatgcaatgatggaacgagggcctcagactttaaaggagaca
tccttcaatcaggcctatggcagagatctcatggaagctcaagagtggtgcaggaagtat
atgaaatcaggaaatgtcaaagacctaactcaggcttgggatctctattatcacgtgttc
cgacggatctccaagcagctgccacagctcacttctttggagctacagtatgtgtcacca
aaactcttaatgtgccgggatctggaattggcagtgccaggaacgtacgatcccaaccag
cccatcatacggattcagtccatcgctccttctctgcaggtcatcacctccaagcagcga
cccaggaagttgacattaatgggaagcaatgggcatgagtttgtattccttctgaaaggt
cacgaagaccttcgccaagatgaaagagtgatgcagctttttgggttggtcaacactctg
ttggcaaatgacccaacttctcttcgtaaaaacctcagcatccagagatatgctgttatt
ccactgtctacaaattcaggcttaattggctgggtgccccactgtgacacactgcacgca
ctcatccgggactacagggagaagaaaaagatcctgctcaacattgagcatcgcatcatg
ctgaggatggctccagactatgaccacctgactctgatgcagaaagtagaagtatttgaa
catgctgtcaataacacagctggggatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtgtggtttgacagaagaacaaattacacccgttcactagctgtgatgtca
atggttgggtacattttgggccttggggacagacacccttccaatctgatgttagacaga
ctgagtggaaagatcctgcatatcgactttggggactgttttgaggttgcaatgacaaga
gaaaagttccctgagaagattccatttagattaacaaggatgctgacaaatgctatggag
gtgacaggcctcgatgggaactacagaatcacctgtcatacagtgatggaagtgctgcgt
gagcacaaggacagtgtcatggctgtgctggaagcctttgtgtatgatcccttattgaat
tggagactgatggacacaaataccaagggcaataagcgctcacgaacaagaacagactcc
tactcaaccagtcagtcagtggaaatgttggacagtgtggaattgggtgagacagcccac
aaaaaaactggaaccacagtgcctgaatccatccattccttcataggagatggtctggtg
aagccagaagctctaaataagaaggcaattcagatcatcaacagggttcgagataagctc
accggtcgagacttctctcatgacgaaactctcgatgtacccacacaagtagaactgctc
attaaacaagcaacttcccatgagaacctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system