KEGG   Serinus canaria (common canary): 103820977Help
Entry
103820977         CDS       T05755                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00020  Citrate cycle (TCA cycle)
scan00190  Oxidative phosphorylation
scan01100  Metabolic pathways
scan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103820977 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103820977 (SDHB)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103820977 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 103820977
NCBI-ProteinID: XP_018775843
LinkDB All DBs
Position
Unknown
AA seq 297 aa AA seqDB search
MLQEKVGKSKGSTPGKVCFSLDLSLFFPGSGVGSEAVFPRPQVLRQAQTAAAAPRLKKFA
IYRWDPDKAGDKPRMQTYEVDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAM
NIGGGNTLACIKKIDSDLSKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDES
KEGKQQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSR
DEFTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKQKAATA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggagaaggttgggaagagcaagggcagcactccaggaaaagtctgtttttcc
ctggatctgagtctgtttttccctggatctggggtgggatctgaggctgtttttccccgg
ccccaggtgctgcggcaggcgcagacggcggcggcggcgccacggctgaagaaattcgcc
atctacagatgggaccccgacaaggccggggacaaaccccgcatgcagacctacgaggtg
gacctgaacaagtgtgggcccatggtgctcgatgccctgatcaagatcaagaacgagatg
gactccacgctgaccttccgcaggtcctgcagagaggggatctgcggctcctgtgccatg
aacatcggcgggggcaacaccctggcctgcatcaaaaaaatcgacagtgacctcagcaaa
gtcaccaaaatctaccccctgccccacatgtacgtggtgaaggacctggttccggacctg
agtaacttctacgcccagtacaaatccatcgagccctacctgaagaagaaggacgagtcc
aaggagggcaagcagcagtacctgcagtccatagaggaccgccagaaactggacgggctc
tacgagtgcatcctgtgtgcctgctgcagcaccagctgtcccagctactggtggaatggg
gacaagtacctgggccctgccgtgctcatgcaggcgtaccgctggatgatcgattcccgg
gatgagttcacggaggagcgcctggcgcagctgcaggacccgttctcgctgtaccgctgc
cacaccatcatgaactgcacccgcacctgccccaaggggctgaaccctggcaaagccatt
gctgagatcaagaagatgatggccacctacaagcagaaggcagcgactgcctga

DBGET integrated database retrieval system