KEGG   Serinus canaria (common canary): 103821588
Entry
103821588         CDS       T05755                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
scan  Serinus canaria (common canary)
Pathway
scan04068  FoxO signaling pathway
scan04217  Necroptosis
scan04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103821588 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103821588 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103821588 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scan03000]
    103821588 (STAT3)
Transcription factors [BR:scan03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103821588 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha Tropomyosin_1
Other DBs
NCBI-GeneID: 103821588
NCBI-ProteinID: XP_009094744
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGAAPYLKTKFICVTPTSFSN
TIDLPMSPRTLDSLMQFGNSSEGAESNAGGQFESLTFDMELTPECASSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcgctacctggagcagctccaccag
ctctacagcgacagcttccccatggagctccggcagttcctggccccctggattgaaagc
caggactgggcgtatgctgccagcaaggagtcacacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagtccaacgtcctctaccag
cacaacctgcgtcgcatcaagcagttcctgcagagcagatacttggagaagccaatggaa
atcgcccgcatcgtggctcgctgcctctgggaagaatcccgactcctccagacagctgct
actgcagcccagcaagggggacaggcaacacatccaacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaagatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaatgggaacaaccagtcagtgacccggcagaagatg
cagcagctggagcaaatgctgacagcactggaccagatgcgcaggggcatagtgagtgag
ctggctgggctgctgtcagccatggagtatgtgcagaagatgctggcagatgaggaactg
gcagactggaagaggagacagcagattgcctgcattggtggcccacccaatatctgcctg
gacaggcttgagaactggataacctctctcgctgaatcacagctacagacccggcagcag
atcaagaagttggaggaactgcagcaaaaagtgtcctataagggcgacccaatcgtccag
caccggcccatgctggaggagcgcattgtggagctgttcaggaacctgatgaaaagtgct
tttgtggtggagaggcagccctgcatgcccatgcaccctgaccggcccctggtcatcaag
acgggtgtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggggatgttgctgcacttcggggg
tcccggaagtttaacatcctgggaaccaacaccaaggtcatgaacatggaggagtcaaac
aatggcagcctctcagcagagttcaaacacctgaccctacgggagcagcgctgtgggaat
ggaggccgagccaactgtgatgcctcgctgatagtcactgaggagctgcatctcatcact
tttgagacagaggtgtatcaccaggggctgaagattgacctagagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacgaagcgcgggctc
agcattgagcagctgaccacgctggcagagaaactgctgggaccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgacttggtgaagaagtacatcctggcactgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccagggacctttctgctgcgcttcagtgagagcagcaaggaaggtggcatcacc
ttcacctgggtggagaaggacatcagtgggaagacacagatccagtcggtggagccttac
accaagcagcagctgaacaacatgtcctttgctgagatcatcatgggctacaagatcatg
gatgccaccaacatcctggtgtcccctctggtgtacctatacccagacatccccaaggag
gaggcatttgggaagtactgccgctccgagagccaggaacactcggaagccacggactca
ggtgctgctccgtacctgaagaccaagttcatctgtgtcacccccacctccttcagcaac
accatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagttcggcaacagc
agcgagggcgcggagagcaacgcgggcgggcagtttgagtcgctgaccttcgatatggag
ctgaccccagagtgtgcgtcctcgcccatgtga

DBGET integrated database retrieval system