KEGG   Serinus canaria (common canary): 103821648Help
Entry
103821648         CDS       T05755                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X2
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04210  Apoptosis
scan04625  C-type lectin receptor signaling pathway
scan04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103821648 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103821648 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103821648 (MAP3K14)
   04672 Intestinal immune network for IgA production
    103821648 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103821648 (MAP3K14)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103821648 (MAP3K14)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: STE group
  Other
   103821648 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 103821648
NCBI-ProteinID: XP_009094819
LinkDB All DBs
Position
Unknown
AA seq 938 aa AA seqDB search
MAVMGIACQGAPDPAVKHKKELTAAEGLKETVSEKQSSVCKVEDSKKDIFHSQWKILNDV
ITRGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDHIPNNV
AHATEGRMAPTWRGRHRGRARKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQEDE
SHQSTLYRNSFWVPEFNKDLGYDPLSFEKPAHAPLSMGKLHSPRSQYKTELHKLISPIQC
LNHVWKQRDTVPQPETLHPFPYNILPPNFPHMDNPLHAMKQNALDTYFHGDLNYQDSHLS
GLNLEYNFTKCINQSVQSSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLELK
EQFHEASENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAA
KKVQVEHFRAEELTTCAAVTSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLP
EDRALSYLGQVLEGLEYLHAQNILHGDVKAENVLLSADGSRALLCDFGHSAHLHPDGLGK
CLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKI
AKEPPPLREIPPSCNPLTAEIIKLGLEKEPLQRASASELKTKTSVALEEVGGVRSPWKGE
YREPRHLSLNKENSAQTSLSPTVSPVSEIGSDPKLSVKVSCGSPVLPPPSLEQTEELEGP
HWNEGKELPGTCDPLPLSSTPLPLKSCSHMERATTISEQELQQLEIELFLNSLSQPYSLE
EQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQAEGQSCSWNNLLSRS
RHTDTPSCFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQPV
HYNMEVPDSGIELQCTLAPDCSVSWAWRVKHGQLENRP
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatgggaattgcatgccagggagctcctgacccagccgtcaagcataaaaag
gagctcacggccgccgaggggctgaaggagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggacatctttcatagtcagtggaaaatcctgaatgatgta
atcaccagaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttgtcagagagatccttt
attgcccacagtaaacgttacagccgctcagacagcctcgatcacatccccaacaatgtg
gcccacgccacggagggcaggatggcacccacctggagagggaggcaccggggcagggcc
aggaagaaaaggcacaagaaaagatccaagctaaaaggacaacctgtggctgctggcagg
agaagtccaagaactccagaacaggagagctgcaccccaattcctgtccaggaggatgaa
tcccaccaaagtactctttacagaaacagtttttgggttcctgaatttaacaaggacttg
ggctatgatccactgtcttttgagaagcctgcccatgcccctttgtccatgggcaaactc
cattccccaaggagccagtacaaaactgaactgcacaagctgatcagccctattcagtgc
cttaatcatgtttggaaacagagggacactgttccccagcctgagactctccatcctttt
ccctacaacatccttccccccaacttcccacatatggacaatcctctccatgccatgaag
cagaatgctctggacacatacttccatggggacctcaactatcaggacagtcacttatct
ggcctaaacttagaatataatttcaccaaatgcatcaaccagtccgtgcaaagcagttca
gataagctttctgtggaagaatatttggtagatgccttgaaggggagcgtgagttttggt
gaaccacaaaatttagccagcctggccaagacgtggagaggaggtgggctggagctgaag
gaacaattccatgaagcaagtgaaaatgaaggcgtgctgctgaacgagaagctgaagccg
gtggattacgagtaccgagaagaggttcactggaccaagtgccatggttccttgggcatt
ggctcttttggggaggtgtacaagatagaggacaagcagacaggattccagtgtgctgcc
aagaaggtgcaggtggaacacttccgtgccgaggagctgacgacgtgcgcggccgtgacg
agccccagcgtggtgcccctgtacggcgccgtcaaggagggtccctgggtcaccatcttc
atgaagctcatggagggtggctcattagggcagctcattaaacagagtggctgcctgcca
gaggacagagccctcagctacctgggccaggtactggagggtctggagtatcttcatgct
caaaacattctccatggagatgtcaaagctgagaacgtgctgctgtcggccgatgggagc
agggccctcctgtgtgactttggccactctgctcacctgcacccagatgggctgggaaag
tgcttggtcacagggaactacgtgcctggcacagagacccacatggcccccgaggtggtg
atggggaagcgctgtgactccaaggtggacgtgtggagcagctgctgcatgatgctgcac
atgctcaatggctgccacccctggacccagtactacaaccaccctctctgcctgaagatc
gctaaagagccgcctcctctgagggaaattccaccttcctgcaaccctctcactgctgag
attattaaactggggctggagaaggagcctctgcagagggcatctgcatcagagctcaaa
actaagaccagcgtggcactcgaagaagtgggaggtgtgagaagcccctggaaaggtgaa
tacagagagcccagacatttatctttgaacaaagaaaacagtgcccagacatccctgtcc
cccacagtgagcccagtttctgagattggttctgacccaaaattgtcagtcaaagtttcc
tgtggcagcccagtcctaccacctccatccctggagcaaacagaggagcttgagggaccc
cactggaatgagggcaaggagttacctgggacctgtgatcccctacctctctcctcaact
cctctgcccctgaagagctgcagccacatggaaagagccacaaccatttcagagcaagaa
cttcagcagctggaaattgaactgttcctgaacagcctttcccagccttactctctggaa
gagcaagagcaaatgctttcatgcctcagcattgacagcccctttgtgtcagatgccagt
gagaagaactccatgaaggcttctcacagcttgagggacaccatgagctctgggatccat
tcctggaacagccaggcagaggggcagagctgcagctggaacaacctgctgagccgcagc
cggcacacggacacccccagctgcttcaacggagtgaaaatccagatccagttgctaagt
ggagaaaatttgcacatcagggatttccacaggacaaaggtgggagacattgccacgggg
ataagcagccagatccccgtgcctgccttcagcctggtgaccaaggaggggcagcctgtg
cactacaacatggaggtgcctgactctggcatcgagctgcagtgcaccctggcccccgac
tgcagcgtcagctgggcctggcgtgtcaagcatggccagctggagaacaggccctga

DBGET integrated database retrieval system