KEGG   Serinus canaria (common canary): 103821656Help
Entry
103821656         CDS       T05755                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:scan01002]
    103821656 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scan04147]
    103821656 (ACE)
   04090 CD molecules [BR:scan04090]
    103821656 (ACE)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103821656 (ACE)
Peptidases [BR:scan01002]
 Metallo Peptidases
  Family M2
   103821656 (ACE)
Exosome [BR:scan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103821656 (ACE)
CD molecules [BR:scan04090]
 Proteins
  103821656 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 103821656
NCBI-ProteinID: XP_009094827
LinkDB All DBs
Position
Unknown
AA seq 1277 aa AA seqDB search
MPAALGLLLWLSLAGALRSHLEPPHYDSTEEGAARFASDYNSSAEIILFNSVSASWNYST
NLTAENAERQVAASLEEQNFTELWGKKAKELYGDKWNNFSDPQLRKIIGSIQTLGPSNLP
VDMREQFNTILNDMDKIYSTAKVCLPNGTCWDLEPDLSDIMATSRSYKKLLYAWEGWHNA
AGIPLRPKYQEFVQLSNAAYSQDGFNDTGSYWRSWYDSDTFEKDLEDLYNQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPNLDVTSAMVQQ
GWNATHMFRVSEEFFTSLGLLEMPPEFWKESMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEHLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLALSVSTPSHLR
KIGLLSNAAEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYDWWYL
RTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPLH
TCDIYRSKEAGDKLREVLKAGSSKSWQEILLNLTGKGQMDAGALLEYFSPVTKWLQEQNK
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEEVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDESVTRILKKLSVIERAALPEE
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAAVLNGYTDNGAYWRSLYETSTFEEDLERLYQQLQPLYLNLHAY
VRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSSIFDLVVPFPDATKVDATPAMKNQGW
TPKRMFEESDHFFTSLGLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVMENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNKEWWNLRL
KYQGLCPPALRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHQGPLHTC
DIYQSKEAGKLLGDALKLGFSKPWPEAMQLITGQPNMSAEALMNYFEPLRIWLEKENQKN
GEVLGWPEYSWTPYTAQDDSSKTDFLGMSLTKSQATAGGWVLLALALIFLITTIFFGVKF
FLARGKTFTSISEMELK
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggcgctggggctgctgctgtggctgagcctggcaggtgcccttcgctcccac
ctcgaacccccccactacgacagcaccgaggaaggggccgcccgcttcgcctcagactac
aacagctcggccgagatcatcctcttcaacagcgtctcggccagctggaattacagcacc
aacctgacggccgagaatgctgaacggcaggtcgcagcatccctggaggagcagaacttc
acagagctatgggggaagaaagccaaggaactctatggcgacaagtggaataacttcagt
gacccccagctgaggaaaatcattggatcaatccagaccttgggaccctccaacctaccc
gtggacatgagagagcagttcaacaccatcctaaatgacatggacaaaatctactccacg
gccaaggtgtgcctgcccaatggcacctgctgggatctggagccagacctgtcggatatc
atggccacgtcccggagctacaagaagctgctgtacgcctgggagggctggcacaacgcc
gcggggatcccgctgcgccccaagtaccaggagttcgtgcagctgagcaacgccgcctac
tcgcaggatggattcaatgacacaggcagctactggcgctcctggtacgactcagacacc
tttgagaaggacctggaggacctctacaaccagctggagccactctacctcaacctgcac
gccttcgtccggaggaagctgtacgaccgctatggacccaaatacatcaacctgaagggg
cccatccctgctcacctcctgggcaacatgtgggctcagcagtggaacaacatctatgac
ctgatgatcccctaccctgagaaacccaaccttgatgtcacgagcgccatggtgcagcag
ggttggaatgccactcacatgttccgggtctcagaggagttcttcacctccctggggctc
ctggagatgccccctgaattctggaaggagtccatgctggaaaagccaacagatgggcgg
gaggtggtgtgtcatgcctcggcctgggacttctacaaccgcaaggacttcaggatcaag
cagtgcacatcggtgaccatggagcatctgttcacagtgcaccatgagatgggccacatc
cagtactacctgcaatacaaggaccagcccgtgtccttccgcagcggggccaaccctggc
ttccacgaggccatcggtgatgtcctggccctctctgtctccacccccagccacctcagg
aaaatcggtctcctcagcaatgctgctgaggatgaagagagcaatatcaactacctgctg
aagatggccctggagaagattgccttcctgccctttggctacctcattgaccagtggcgc
tggaacgtcttcagtggccacacgccgccaagccgctacaactacgactggtggtacctg
agaaccaaataccagggcatctgcgccccgatttcaaggaatgagagcaactttgaccct
ggagcaaagtaccacatcccagggaacactccttacatcaggtactttgtgagcttcatc
ctccagttccagtttcacaaggcactgtgccaggcagccaaccacaccggtcccctgcac
acctgtgacatctacaggtccaaagaggctggagacaaactcagagaagtgttgaaagct
gggtcctcgaagtcgtggcaggaaatcctcttgaatctcactggcaagggccagatggat
gctggagcccttctggagtatttcagccctgtcaccaagtggcttcaggagcagaacaaa
aagaccaatgaggtgctgggctggcctgagtttgactggcgtccccctgtccctgaaggc
taccctgaaggcattgacaaaatagcagacgaggcacaagctaaagagttcttgtccgag
tacaacagcacggctgaggaagtgtggaatgcctacaccgaggcatcctgggcctacaac
accaacatcactgaccacaacaaggagatcatgctggagaagaacttggccatgtccaag
cacaccctggagtacggcatgagggccaggcagtttgacacctccgatttccaggatgaa
agtgtcacccgcatcctcaagaagctgagtgtcattgagagggcagccttacctgaggag
gaactgaaggagtataacaccctgctctcagacatggagaccacctacagcgtggccaag
gtctgcagagagaacaaaacctgtcacccactggatcctgacctcacagacatcatggcc
acctctcgggactatgacgagctcctcttcgcctggaagggctggagggatgcttctggg
aagaagatgaggaacaactacaagagatatgtggagctgagcaacaaggcagccgtgctc
aatggctacacagacaatggggcctactggagatccctgtatgagacatccaccttcgag
gaagatctggagaggctgtatcagcagctgcagcccctgtacctcaacctgcatgcttat
gtacgccgagccctctacaaaaagtatggtgcagagcacatcaacctgaagggtcccatc
cctgcccatctgctgggcaacatgtgggctcagtcatggtccagcattttcgacctggtg
gtccctttcccagatgccaccaaggtggatgccaccccagccatgaaaaaccagggctgg
acacccaagagaatgtttgaagagtcagaccatttcttcacctccctgggcctcatcccg
atgccacaggagttctgggacaagtccatgatcgagaagccgtcggatgggcgggaggtg
gtgtgccacgcctcagcctgggatttctacaaccgcaaggacttcaggatcaagcagtgc
acagtggtgaacatggacgacctcatcacagtgcaccacgagatgggccacgtccagtac
ttcctgcagtacaaggaccagcctgtctccttccgtgacggggccaaccctggcttccat
gaggctgttggggatgtcatggccttgtccgtctccacccccaaacacctccacagcatc
aatctgctggaccaagtcatggaaaacgaagaaagtgatatcaactatctgatgagcatc
gccctggacaaaattgccttcctgcccttcgggtacctcatggaccagtggcgctggaag
gtgtttgatgggcggatcaaggaggacgagtacaacaaggagtggtggaacctcaggctg
aagtaccagggcttgtgcccaccagcactgaggtctgaagatgacttcgaccccggggca
aagtttcacattcctgccaacgtcccttacattaggtacttcgtcagctttgtgatccag
ttccagttccaccaggcactctgtgatgcagctgggcaccagggtcccctgcacacctgt
gacatctaccagtccaaggaggctgggaagctcttgggggatgccctgaagctgggtttc
agcaagccatggcctgaagccatgcagctcatcacaggacagcccaacatgtcagcagag
gccctgatgaactactttgagccactcaggatatggttggagaaagagaaccagaagaat
ggggaggtcctgggctggcctgaatacagctggactccttacacagcccaagatgactcc
agcaaaactgatttcctgggaatgtccctgaccaaaagtcaagccacggctgggggctgg
gtcctgcttgccctggcactcatcttcctgatcaccaccatcttcttcggtgtcaagttc
ttcttagccaggggaaagaccttcacatccatctcagaaatggaactgaaataa

DBGET integrated database retrieval system