KEGG   Serinus canaria (common canary): 103821871Help
Entry
103821871         CDS       T05755                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:scan01002]
    103821871 (TMPRSS9)
Enzymes [BR:scan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103821871 (TMPRSS9)
Peptidases [BR:scan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103821871 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 103821871
NCBI-ProteinID: XP_018777257
LinkDB All DBs
Position
Unknown
AA seq 1076 aa AA seqDB search
MDQIKPGQGTQRRRLGACCWKVTTAAAVAGSATALCLGILLACHSTGEASFEHTVELQGI
TFNSSLQTENSDYYRVLTPALERLFLSSLQDSQLNWSCTGCTILGYRNGNSSVIVHFRLL
FTPQDSQPLSSTLEEEAFRHGLAAALHKQGFSLAAYGTISSASLTGPNKVSSHRPGLKSD
CGSRPAMQTASRIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQD
PAMWAAYTGTTSLRGSDGSAVKMDISQIIPHPSYNADTADYDVAVLELKKPVTFTKYIQP
VCLPDAGHHFPTSKKCLISGWGYLKEDFLVKPEFLQKATVELLDQNLCSSLYSHVLTDRM
MCAGYLEGKVDSCQGDSGGPLVCQEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTKLRDW
ILDAISAFPTSIAHTVPPVHFRTNSNMVSAKEVNTTTGATPTTLPAPAASRPVAAAGPQE
CGERPGFSKPSKIVGGTDASRGEIPWQVSLKEDSRHFCGATIIGDRWLLSAAHCFNETMP
EEIEAFVGTTSINGTDENAVKVNVTRVIPHPLFNPMILDFDVAVLELARPLVFNKYIQPV
CLPLAMQKFPVGKKCLISGWGDLQEGNDTKPEILQKASVGIIEQNTCNFLYNFSLTDRMI
CAGFMEGMVDSCQGDSGGPLACEVTPGVFYLAGIVSWGFGCAQAMRPGVYSRITKLTDWI
LDTISQLPSGGTSIPSSSAVPRTSTTAIFMQPSTMAAGPASRTTLWTKMSITMSETSTAL
RTTETAKPTQTPVVPCTSLTFKCSSKVCIEKENPECDGVVDCSNGFDEHNCDCGSTAALA
FSKIVGGSNAARGEWPWQVSLWLQRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAYL
GTPFLSGIDGKMEKIFRIYKHPFYNVYSLDYDVALLELSTPVTFSSTIRPICLPDHSHIF
HEGARCFITGWGSTKEGGLMSKHLQKAAVNMIGDQACKKFYPVQISSRMLCAGFPQGTVD
SCSGDAGGPLACKEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIVQNLKL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggaccagataaagccagggcaaggcacccagaggaggagactgggggcctgctgctgg
aaggtaaccactgctgctgccgtggcaggcagtgcaacagccctctgcctggggatcctg
ctggcctgccattccacgggagaggccagctttgagcacacagtggagctgcaaggaatc
accttcaatagcagcttacagacagagaactcggactactacagggtgctgacacctgct
cttgagaggctgtttctgtccagtctccaggactcccagctgaactggagttgtactggt
tgcaccatcctaggctacaggaatggaaactccagtgtgatcgtccatttccgcctcctc
ttcaccccccaggattcccaacccctgagctctaccttggaagaggaagctttcaggcat
gggctggcagctgccctgcacaagcagggtttctccctggctgcctatgggaccatctcc
tcagcctctctcacaggtcccaacaaggtttcttcccacagacctggactgaaatcagac
tgtgggagtcgccctgccatgcagactgccagcaggatagttggaggctcagaggcatcc
agaggggagttcccatggcaagtcagccttcgagagaacaatgagcacttttgtggcgct
gctatcctcacagagaagtggctggtgtctgctgctcactgctttactgagtttcaggac
ccagccatgtgggcagcttacacagggaccacctccctcagaggctctgatggcagtgca
gtgaaaatggacatttcacagatcatcccacacccctcttacaacgctgacacagctgac
tatgatgtggctgtgctggagctgaagaagcctgtcaccttcactaagtacatccagccc
gtgtgcctgccagatgctggccatcacttccccaccagcaagaagtgccttatctctggc
tggggctacctcaaggaggatttcttggtgaaacctgagttcctgcagaaagcaactgtg
gagctcctagaccagaacctatgttccagtctctacagccatgtcctcacagacaggatg
atgtgtgctggctacctggaggggaaggttgactcctgtcagggtgactctggtgggcct
ctggtttgccaagaaccatctggcaggttttttctggcaggaattgtaagttggggtatt
ggatgtgctgaagccaggcgccctggggtttacacacgtgttaccaaactcagagactgg
atcttggatgctatttctgccttccctacctccatagcccatactgttcctccagtgcac
ttcaggactaacagtaacatggtcagtgctaaagaggtcaacaccaccaccggagcaacc
ccgaccaccttaccagccccagctgccagcaggccagtggctgcagcagggccacaagag
tgtggagaacgacccggattctctaaacccagcaagattgtgggagggacagatgcttcc
agaggagagatcccttggcaagtcagcctaaaagaagactccagacatttctgtggagcc
accatcattggggaccgctggctgctgtcagcagctcactgcttcaatgagacaatgcca
gaagagattgaagcctttgtgggaacaacatcaataaatggaacagacgagaatgcagtg
aaagtcaatgtaacaagagtgatcccacatcccctcttcaaccccatgatactggatttt
gatgtggctgtacttgaactggcaagacctcttgtcttcaacaaatacatacagcctgtg
tgcctcccccttgccatgcagaagtttcctgttggcaagaaatgcctcatttctggatgg
ggtgacctccaggaagggaatgacaccaagcccgagatcctgcagaaagcatctgtaggc
atcatagaacaaaacacctgcaacttcctctacaacttctccctcactgaccgaatgatc
tgtgctggcttcatggaggggatggtagactcatgccagggagattcaggtgggcccttg
gcctgtgaggtgaccccaggcgtgttttaccttgctggcattgtgagctggggatttggt
tgtgcccaggctatgagacctggtgtgtactccagaattaccaaactcacagactggatc
ctggacaccatctcccagttgcccagtggtggcacaagcatcccttccagttcagccgtc
cctagaacttctaccacagccatttttatgcagcccagcacaatggctgcaggcccagct
agcagaaccaccctgtggacaaagatgagtataaccatgagtgaaacctccacagctctg
agaacgaccgagactgccaagcctacccaaaccccagtggtgccttgtaccagcctcact
ttcaagtgttccagcaaggtgtgtattgaaaaagaaaatcctgaatgtgatggtgttgtg
gactgcagcaatggattcgatgagcacaactgtgactgtgggtcaacagcagctctggcc
tttagcaagattgtgggtggcagcaatgcagctcgaggagaatggccctggcaagtcagt
ctctggcttcagcggaaggagcacaagtgtggggctgttcttattgctgaccggtggctg
ctctctgcagctcattgctttgacatttacagtgaccccaaaatgtgggtggcctatcta
ggaacacccttcctgagtggcatcgatggcaaaatggagaaaatatttcgtatctacaaa
caccctttttacaacgtctacagcctagactatgatgttgcactactggagctgagcaca
cctgtcacgttcagcagcaccatcagacctatatgtctcccagaccattctcacatcttc
catgaaggggccagatgcttcatcacaggctggggctccacaaaggaaggaggtctcatg
tcaaagcatctgcaaaaagcagcagtgaacatgatcggagaccaggcctgcaaaaagttc
taccctgtccagatcagcagcaggatgctgtgtgctggtttcccacagggcaccgtcgac
agctgctcaggtgatgcaggtgggcccctggcatgtaaagaaccttcagggaagtggttt
ctagcaggaatcacaagctggggctatggctgtgccaggccatacttccctggtgtctac
accaaagtcacagctgtccaaggctggattgtgcagaacctcaagctctga

DBGET integrated database retrieval system