KEGG   Serinus canaria (common canary): 103822217
Entry
103822217         CDS       T05755                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
scan  Serinus canaria (common canary)
Pathway
scan04068  FoxO signaling pathway
scan04110  Cell cycle
scan04115  p53 signaling pathway
scan04218  Cellular senescence
scan04310  Wnt signaling pathway
scan04340  Hedgehog signaling pathway
scan04371  Apelin signaling pathway
scan04510  Focal adhesion
scan04530  Tight junction
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103822217 (CCND1)
   04340 Hedgehog signaling pathway
    103822217 (CCND1)
   04371 Apelin signaling pathway
    103822217 (CCND1)
   04068 FoxO signaling pathway
    103822217 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103822217 (CCND1)
   04115 p53 signaling pathway
    103822217 (CCND1)
   04218 Cellular senescence
    103822217 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103822217 (CCND1)
   04530 Tight junction
    103822217 (CCND1)
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 103822217
NCBI-ProteinID: XP_018777447
LinkDB
Position
Unknown
AA seq 153 aa
MELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRKHAQTFVALCATDIKFISNP
PSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCDPDCLRACQEQIESLLESSL
RQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgat
ttcattgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgt
aaacatgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaaccca
ccctccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaac
actaacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgt
gatccggattgtttacgagcctgccaagaacagattgagtccctcctggagtccagtcta
cgccaggcacagcagcacaacatatcctcagaaacaaagactgtagaggacgaagcagac
ctctcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system