KEGG   Serinus canaria (common canary): 103822335
Entry
103822335         CDS       T05755                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
scan  Serinus canaria (common canary)
Pathway
scan04012  ErbB signaling pathway
scan04068  FoxO signaling pathway
scan04110  Cell cycle
scan04115  p53 signaling pathway
scan04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103822335 (CDKN1A)
   04068 FoxO signaling pathway
    103822335 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103822335 (CDKN1A)
   04115 p53 signaling pathway
    103822335 (CDKN1A)
   04218 Cellular senescence
    103822335 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103822335
NCBI-ProteinID: XP_030089453
LinkDB
Position
Unknown
AA seq 165 aa
MTDSHFSHCHLVTATTMPLSQSRAGQTPCSSKACRNLFGPVDHEQLQHDFEDKMKQQLEE
AQQRWNFNFETETPLEGPFKWERILVAEQPPQEVHSLVRAVISSDSRSSLAHRVPPKERV
GRICPEEAQQSSKVYKAGSLQKRGQTTIKDFYSAKRRIVPARPRP
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactgattcacacttttcccactgtcaccttgtcactgccaccacgatgccgctgtcc
cagagcagggctgggcagaccccgtgcagcagcaaggcctgcaggaacctctttggcccc
gtggaccacgagcagctccagcatgactttgaggacaagatgaaacaacagctggaggaa
gctcagcagcgctggaacttcaactttgagacagagactcccctggaagggccgttcaag
tgggagaggatcctggtggctgagcagccaccccaggaagttcacagcctggtcagggct
gtcatcagcagtgacagcaggagctccctggcccacagggtcccccccaaggagcgtgtt
ggcaggatttgccctgaggaggctcagcagagctcgaaggtttacaaggctggttccctg
cagaaacgtgggcagaccacgatcaaagacttctacagtgccaagaggaggatcgtccct
gcccggccccggccgtga

DBGET integrated database retrieval system