KEGG   Serinus canaria (common canary): 103823392
Entry
103823392         CDS       T05755                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103823392 (CACNA1E)
   04020 Calcium signaling pathway
    103823392 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:scan04040]
    103823392 (CACNA1E)
Ion channels [BR:scan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103823392 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 103823392
NCBI-ProteinID: XP_030082615
LinkDB
Position
Unknown
AA seq 2239 aa
MALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALE
QHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVL
SGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLF
FAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGI
TQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGV
LSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEV
LRRATIKRNRTDAMSGDEQCVDISSVGERRLAQRRRLNPTLGNPSSHSGLKGARVDGASY
LRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLG
LFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLL
RIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPS
ANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNV
FLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMS
MWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKRP
GEGVTLEKCAEEQGKAEREGLEQVVPGANPGGGEERTSPRAKRDMWQQKSCHGNCEPGEQ
DGAGGSMEDRARMRPSQRRSRHRRARVEGKDTAGILGSRSASQEMGLEEASTAEGTQDGD
RHGDVAAAEALIPGEPEASGESIRTNGVPAGDADLIGTTKKGSPPHVAAELSQGKTGTLT
EQECSSPDTSEQALLEPRRSVCRSEPDLSSITPNTEKATESTAIMIDVHDSAVVQISNKT
DGEASPLKEAETKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNL
RYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLIL
QDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRL
PKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTQKDCIGN
YVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPS
RSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAIS
AKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKY
LNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNM
SFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNI
KLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENE
RCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYD
RAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMAL
IRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAM
MIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSR
GGFPSLSPLSPQEIFQLACMDPAQEQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHA
VSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRPNSSWLDEFSMERSSDNTYKSRRRS
YHSSLQLSARRLNADSGHRSEGHRSGRERGRSKERKHLLSPDISRCNSEERSPQAQEESP
ERRRESRSPSEGRSQTPSRQGMGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYA
SMLRHAGDTSPPADESEGGSPLLSSSLDPSTAGPAESSSSPAGKQSRQSTPQRYISEPYL
ALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHGWQMPNGHYRRRRRGAAQG
VMCGASIDVLSDTEEDDKC
NT seq 6720 nt   +upstreamnt  +downstreamnt
atggctctgtacaaccccatccccgtccggcagaactgcttcaccgtcaacagatcgctc
ttcctcttcggggaagagaacatagtcaggaaatacgccaagaagctcatcgactggcct
cccttcgagtacatgatcctggcgaccatcattgccaactgcatcgtgctggccctggag
cagcacctccccgaggatgacaagacacccatgtcacggagattagagaagacagagccc
tacttcattgggattttctgcttcgaggctgggattaagattgtggccctggggttcgtt
ttccacaagggctcgtacctgcgcaacggctggaacgtcatggacttcatcgtggtgctc
agcggcatcctcgccacggccgggacacacttcaacacccacgtggacctgcggacgctg
cgggctgtgcgcgtgctcaggccgctgaagctcgtctcgggcattcccagcttgcagatt
gtgctgaaatccatcatgaaggccatggtgcctctcctgcagatcggcctgctgctcttt
tttgctatcctcatgtttgccatcattggcctggagttctacagcgggaagctgcaccga
gcctgctacacaaacaattcaggtgaactagaggagctggaccctccccatccctgcggg
gtgcagggttgccccccgggctacgagtgccgggagtggatcggtcccaacgacgggatc
acgcagttcgacaacatcctctttgctgtgctgaccgtcttccagtgcatcaccatggaa
gggtggaccacagtcctgtacaacaccaatgatgccttaggagccacctggaactggctg
tacttcatccccctcatcatcattggatccttctttgtcctcaaccttgtcctgggagtg
ctgtcaggggagtttgccaaagagagagagcgcgtggagaaccgccgagccttcatgaag
ctgcggcggcagcagcagatcgagcgggagctcaacggctaccgggcgtggatagacaaa
gcggaggaagtcatgctggctgaagagaacaaaaattcggggacctcagccttagaagtg
ctccggcgagccaccatcaagcggaaccgcacggatgccatgtcgggtgacgagcagtgt
gtcgacatctcctccgtgggcgagcggaggctggcgcagaggagacgtctcaatccaacc
ttgggcaacccctcgagtcactctggcctcaaaggagccagggtggacggtgcctcctac
ttgcggcacaaggagcggctcctgcgcatctctgtccgccacatggtcaaatcccaggtc
ttctactggatcgtcctgagcctggtggctctcaacactgcctgcgtggccatcgtccat
cacaaccagccagcctggctcacccacttcctctactatgcagagttcctgttccttggg
ctcttcctcctggagatgtccttaaagatgtatgggatggggccacgcctttacttccat
tcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttcgaagtggtttgg
gctatattcagaccaggaacctcttttgggatcagtgtcctacgagctcttcgtctcctg
aggatatttaaaataaccaagtactgggcatccctgaggaatttagtggtctcgctgatg
agctccatgaaatctattatcagtctgctcttcctcctcttcctcttcattgtagtgttt
gccctgctgggaatgcagctgtttggaggcaggtttaacttcatggatgggactccctcg
gccaactttgacaccttccctgcagccatcatgacagtgtttcagatcctgacaggcgag
gactggaacgaggtgatgtacaacggcatccgctcccagggaggcgtgcgctcagggatg
tggtcctccatctacttcatcgtcctcaccttgtttgggaactatactctgctgaacgtc
ttcttggccatcgccgtggacaacctggccaacgcccaggagctcaccaaggacgagcag
gaggaagaggaggcctttaaccagaagcacgcccttcagaaagccaaagaagtcagcccc
atgtctgccccaaacatgcctgctatcgaaagagacaggcggaggagacaccacatgtcg
atgtgggagccacgcagcagccacctgcgggagcgtcggcggaggcaccacatgtcggtg
tgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggagggcatc
aacaaggacgagccgcccctcatcaatccccacgccagcatcttccgcaggaagaggccc
ggagagggtgtcaccctggagaaatgcgctgaggagcagggcaaggcagagcgcgaggga
ctcgagcaggtggtgccaggggccaaccccggcggtggggaggagaggacatcaccgcgg
gccaagcgggacatgtggcagcagaagtcttgccatgggaactgcgagccaggagaacag
gacggggcaggaggcagcatggaggatagggccaggatgaggccgagccagcggcgcagc
cggcaccgcagagcccgcgtggagggcaaggacacggctggcatcttggggagccgctcg
gccagccaggagatggggctggaggaggccagcactgccgaggggacgcaggatggggac
aggcatggggacgtggctgcggcagaggcgctgattccgggggagccagaggcgagcggg
gagtccatcaggacaaacggggtccctgctggcgatgccgatctgattggcaccaccaag
aagggcagccccccgcacgtggcagccgagctctcccaggggaagacaggcaccctgacg
gagcaggagtgcagcagcccagacacgagcgagcaggcactgctggagcccaggcgcagc
gtgtgccgcagcgagcccgacctgtcctccatcacccccaacaccgagaaggccaccgag
agcacggccatcatgatcgatgtgcacgactccgctgtggtacagattagcaacaagaca
gacggcgaagccagccccttaaaggaagctgagaccaaagaggatgaggaagaaatggag
aagaagaagaggaagaaggaaaagagcgagacgggcaaagccatggtgccgcacagctcc
atgttcatcttcagcaccaccaacccggtgaggagggcctgccactacattgtgaacctg
cgctacttcgagatgtgcatcctgctggtgatcgctgccagcagcatcgccctcgccgcc
gaggatcccgtcctcaccaactccgaccgcaacaaagtgctgaggtatttcgactacgtc
ttcactggtgtcttcacctttgagatggtgatcaagatgattgaccagggcttgatcctg
caggatggctcctacttccgagacctctggaatatcctggatttcatcgtggtggtggga
gcgctggtggcctttgccttggcgaatgctttggggaccaacaagggccgggatatcaag
accatcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaagagactg
cccaagctgaaggctgtttttgactgtgtagtgacatctctcaagaacgtcttcaacatc
ctcattgtctacaagctcttcatgttcatcttcgccgtcatcgccgtgcagctcttcaag
gggaagttcttctactgcactgacagctccaaggacacgcagaaggactgcatagggaac
tacgtggaccacgagaagaacaagatggaggtgaaatgcagggagtggaagcggcacgag
tttcactatgacaacatcatctgggctctgctcaccctgttcacggtgtccaccggcgag
gggtggccccaggtgctgcagcactcggtggatgtgacggaggaggaccgcgggcccagc
cgcagcaaccgcatggagatgtccatcttttatgtcgtctactttgtggtcttccccttc
ttcttcgtcaacattttcgtggccctcatcatcatcaccttccaagagcaaggagacaaa
atgatggaggagtgcagcctggagaagaatgagagggcctgcattgactttgccatcagc
gccaagcccctgacgcggtacatgccccagaacagacacaccttccagtaccgcgtgtgg
cacttcgtggtgtccccgtccttcgagtacaccatcatggccatgatagccctcaacacc
gtggtgctcatgatgaagtactattctgctccatacacctatgagctggccctgaagtac
ctgaacattgccttcaccatggtgttctccctggagtgcgtcctcaagatcattgccttt
ggcttcctgaattatttccgggacacctggaacatctttgacttcatcacggtcattggc
agcattacggagatcatcctgacggacaccaagctggtgaacaccagcagcttcaacatg
agcttcctgaagcttttccgggctgctcggctcatcaagctgctccgccagggttacacc
atccgcatcctgctctggacctttgtgcagtccttcaaggcactcccctatgtctgcctg
ctgattgccatgcttttcttcatctacgccatcattgggatgcaggtttttggcaatatc
aaactcgatgaggaaagccacattaacaggcacaacaacttccgcagcttcctgggctcc
ctcatgctcctcttcaggagtgccactggagaggcgtggcaggagatcatgctgtcctgc
ctggagggcaagggctgcgagccggacaccacggcgacgtccgggcagaacgagaacgag
cgctgcggcactgacctagcctacgtttacttcgtgtccttcatcttcttctgctccttc
ctgatgctcaacctgtttgtggcagtcatcatggacaactttgagtacctgacacgggac
tcctccatcctgggccctcaccatctggatgagtttgtccggatctgggcagagtatgac
cgagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgactcttatgtca
ccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagagactggtgctg
atgaacatgcccgtggctgaggacatgacagtccacttcacctccaccctcatggccctg
atccgcacggccttggacatcaaaattgccaaaggtggtgcagattggcagcagttggac
tctgagcttcaaaaggagatcctgaccatttggcctcacctctcccagaagatgcttgac
ctgttggtacccatgccaaaaacctctgacctgactgttgggaaaatttatgcagccatg
atgatcatggattactacaagcagagcaaggcgaagaagcagcggcagcagctggaggag
cagaaaaatgcccccatgttccagcgcatggagccgtcctctctgccgcaggagatcatc
tccaacgccaaggctctgccatacctccagcaggacaccctctcgggcctgagcagccga
ggcgggttcccctcgctgagcccgctctcgccgcaggagatcttccagctggcgtgcatg
gatccagcccaggagcagttccaggagcaccagtctctggagccagaggttagggagttt
caaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcaggaccacgct
gtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtggtgacagac
accagctccatgcggagatcgttctccaccatccgggacaagcggcccaacagctcctgg
ctggatgagttctccatggagcgcagcagcgacaacacctacaagtcccgccggcgcagc
taccactcctcgctccagctatccgcccggcgcctcaacgccgactcgggccaccggtcc
gaggggcaccgctcgggcagggagcgaggccgatccaaagagcgcaagcacctgctgtcc
ccggacatctcccgctgcaactccgaggagaggagtccccaggcgcaggaggagtcgccg
gagcggcggcgcgagtcccggtcacccagcgagggcaggtcacagacacctagcaggcag
ggcatgggctccctgagcgaaagctccatcccctccatctcggacaccagcacgccccgg
cgaggccgccgccagctgccgccggtgccccccaagccgcgtcccctcctgtcctacgcc
tccatgctgcgacacgcgggggacacctctcctccggccgacgagagcgagggcggctct
ccgctgctctcctccagcctggatcccagcacggccggcccggcagagtcttccagctct
ccggcgggcaagcagagccggcagtccacgccgcagcgctacatctcggagccctacctg
gcgctgcacgacgactcgcacgcctcagactgcggtgaggaggagacgctcaccttcgag
gcggccgtggccaccagcctgggccgctccaacaccatcggctcggcgccgccgctgcgg
cacggctggcagatgcccaacgggcactaccggcggcggcggcgaggggcggcgcagggc
gtcatgtgcggggccagcatcgacgtgctcagcgacaccgaggaagatgacaagtgctag

DBGET integrated database retrieval system