KEGG   Serinus canaria (common canary): 103823609Help
Entry
103823609         CDS       T05755                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00512  Mucin type O-glycan biosynthesis
scan00514  Other types of O-glycan biosynthesis
scan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103823609 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    103823609 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:scan01003]
    103823609 (GALNT17)
Enzymes [BR:scan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103823609 (GALNT17)
Glycosyltransferases [BR:scan01003]
 O-Glycan biosynthesis
  Mucin-type
   103823609 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103823609
NCBI-ProteinID: XP_030088302
LinkDB All DBs
Position
Unknown
AA seq 691 aa AA seqDB search
MKLRRRRRQRGGRSGAGGPGRPPLRVIVPSGLAAPGLAVPLLASPPAPLAAAIVRPAQPA
GARSPRCARSGGGRRPAPITLPAARRLAGAPREVDGFFEESQSPLVKPDRRAGFVLFLAK
CRPITTKSGDSYHDIHPRAEVANLTAHGISSIQDAVLKRLSLLEDIVYRQLNGLSKSLGL
IEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPTKCKELKY
GKDLPQISIIFIFVNEALSVILRSVHSAVNHTPAPLLKEIILVDDNSDEEELKAPLEEYV
NKRYPGLVKVVRNQKREGLIRARIEGWKAATGQVTGFFDAHVEFTAGWAEPVLSRIQENR
KRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIG
CSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGRMEVLPCSRVAHIERKKKPYN
NNIGFYTKRNALRVAEVWMDDYKWHVYIAWNLPLENPGIDIGDVSERKALRKSLKCKNFQ
WYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLDQGPQENHTAILYPCHGWGPQLARYTRE
GFLHLGALGTTTLLPDTRCLVDTGKSRFPQLLDCDKVKSSLHKRWSFIQNGAILNKGTGR
CLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcggcggcggcggcggcagcgcggcgggcggagcggggcgggcggccccggc
cgccctcctctgcgggtcatagtcccgagcgggctcgccgcgcccgggctcgcggtgccg
ctgctcgccagccctcccgctccgctcgccgccgcgatcgtgcggccagcccagccggcc
ggggcgcgctccccgcgatgtgcgcgcagcggcggcggccgccggcccgctcccataacc
ctgccggcagcgcggcggctggcgggggcccctcgggaagttgatggcttctttgaggag
agtcaaagtcctctggttaaacctgatcgccgtgctggcttcgtcctcttcctggccaag
tgcagacccatcacgaccaagagcggcgactcctaccatgacatccatcccagggcagaa
gtggccaacttgacagcccacggcatcagctccatccaggatgcagtgctgaagaggctc
tcgctcctagaagacatagtctacaggcagctgaatggtctgtccaagtcccttggtctc
attgagggctatggtggccgtggcaagggtggcctcccagccaccctgtcccctgaggag
gaggagaaagccaagggaccccacgagaagtatggctacaactcctacctcagtgagaag
atttccctggaccgttccatcccggattatcgccccaccaagtgcaaagagctgaaatac
ggcaaggacctgccccagatctccatcatcttcatctttgtgaacgaggcgctgtcggtg
atcctgcgctcggtgcacagcgccgtcaaccacacccccgcccccctgctcaaggagatc
atcctggtggacgacaacagcgacgaggaggagctgaaggcgccgctggaggagtacgtc
aacaaacgctacccggggctggtcaaggtggtgaggaaccagaagagggaagggctgatc
cgggcccgcatcgagggctggaaggctgccacgggccaggtcaccggcttctttgatgcc
cacgtggagttcactgctggctgggcggagccggtgctgtcccggatccaggagaacagg
aagagggtgatcctgccctccattgacaacatcaagcaggacaacttcgaggtgcagcgc
tacgagaactctgcccacggctacagctgggagctgtggtgcatgtacatcagccccccc
aaggactggtgggacgccggggacccctccctgcccatcaggaccccggccatgatcggc
tgctccttcgtggtgaacaggaaattcttcggcgagatcggcctgctggaccctggcatg
gacgtgtacggaggggagaacatcgagctgggcatcaaggtgtggctgtgtgggggccgc
atggaggtgctgccctgctccagggtggcccacatcgagcgcaagaagaagccctacaac
aacaacatcggcttctacaccaagcgcaacgcgctgcgcgtggccgaggtctggatggac
gactacaagtggcacgtctacatcgcctggaacctgcccctggagaatccagggattgac
attggggatgtttctgagaggaaagccttgaggaagagcctgaaatgtaaaaatttccag
tggtacctggaccatgtttacccagaaatgaggagatacaacaacaccattgcttatgga
gagctgcggaacaacaaggccaaggacgtgtgcctggaccagggcccgcaggagaaccac
acagcaatcctgtacccgtgccatggctggggcccgcagctggctcgatacaccagggag
ggcttcctgcacctgggggccctgggcaccaccacgctgctgcccgacacgcgctgcttg
gtggacacgggcaagagccgcttcccgcagctgctggactgcgacaaggtcaagagcagc
ctccacaagcgctggagcttcatccagaatggagccatcctgaacaagggcacgggccgg
tgcctggaggtggagaacaggggcatggctggcattgacctgatcctccgcagctgcaca
gggcagaggtggacaattaaaaacttcatcaagtag

DBGET integrated database retrieval system