KEGG   Serinus canaria (common canary): 103823725Help
Entry
103823725         CDS       T05755                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00010  Glycolysis / Gluconeogenesis
scan00051  Fructose and mannose metabolism
scan00052  Galactose metabolism
scan00500  Starch and sucrose metabolism
scan00520  Amino sugar and nucleotide sugar metabolism
scan00524  Neomycin, kanamycin and gentamicin biosynthesis
scan01100  Metabolic pathways
scan01200  Carbon metabolism
scan04910  Insulin signaling pathway
Module
scan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103823725 (HK1)
   00051 Fructose and mannose metabolism
    103823725 (HK1)
   00052 Galactose metabolism
    103823725 (HK1)
   00500 Starch and sucrose metabolism
    103823725 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103823725 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103823725 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103823725 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:scan04131]
    103823725 (HK1)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103823725 (HK1)
Membrane trafficking [BR:scan04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103823725 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 103823725
NCBI-ProteinID: XP_009097104
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGYLITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLAEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHDTAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLREAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgacaagtacctctacgccatgcggctctcagacgaaacgctgctggacgtcatg
gctcgcttcaggagggagatgaagaacggcctctccagggatttcaacccaacagccact
gtgaagatgcttcccacctttgtgaggtccattcctgacgggtcagagaaaggagatttc
attgcactggatcttggtggctcttacttccgaatccttcgggtgaaggtgtcgcacgag
aaaaagcagacggtgcagatggaaagtgaaatttacaataccccagaggacatcatgcac
gggagtggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactgccagtcgggtttacattttccttcccctgtcgacaa
tccaagctagatgagggttatctgataacctggacgaagcgcttcaaagcgagtggagtg
gagggagcagacgtcgtgaggctgctcaacaaggccatcaagaaacgcggggactacgat
gcagacatcatggctgtggtgaacgacaccgtgggcaccatgatgacctgtggctttgac
gaccagcgctgcgaagttggcctgatcatcggcacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggggacgagggcaggatgtgcattaacaccgag
tggggggcctttggagacgacggctcgctggaggacatcaggaccgagttcgatcgagag
attgaccgcggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagaaggtctgaacaaagccaaagagatcctgacccggctgggg
gtggagccgtcccacgaggactgcatcgctgtgcagcacgtctgcaccatcgtgtccttc
cgctctgccaacctggtggcctccacgctgggtgccatcctcaaccagctgagggacaac
aagggcgtgggccgcctgcgcaccaccgtgggtgtggacggctccctctacaagatgcac
ccacagtatgcccggcgcttgcacaagacgacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcggcaagggcgcggccatggtgacggccgtggcg
taccggctggccgagcagcaccgcctcatcgacgagaccctggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcggagatggaggcggggctgaag
aagaagactcacgacacggccaaagtgaagatgctgcccacctttgtgcgcagcacgccg
gatgggacagagaatggagactttctggcacttgacctcggagggacaaactttagagtt
ttgctggtgaaaatccgcagtggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcccatagaggtgatgcagggaacaggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattatatggggataaaaggagcacgtcttcctcttggcttc
accttttccttcccttgcaagcagaccagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtgtatttacttagagaagga
attaaaagaagagaggaatttgacttggatgtggtggctgtggtgaatgacacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaattgggctcattgtgggaacg
ggcagcaatgcctgttacatggaggagatgaggaacatagagatggtggatggtgagcag
ggcaggatgtgtgtgaacacggagtggggagcctttggggacaacggctgcctggatgac
atcaggacaatctatgacaaagcagttgatgacttctccctgaatgctggcaagcagagg
tatgagaagatgatcagtgggatgtacctgggggagatagtccgcaatattttgatcgac
ttcaccaagcggggtttcctgttccgaggccagatttcagagacactgaagaccaggcat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
agaaccatcctccagcagctggggctcaacagcacctgcgacgacagcatcatcgtcaag
acagtctgcggggcagtgtcgaggcgagcagcccagctctgtggtgctggaatggctgcc
attgtagataaaattagggagaacagagggttagagcgcctggagataacggttggtgtg
gatggcactctctacaaactgcacccacacttctcaaggatcatgcaccagacagtcaaa
gatctggcacccaactgcgacgtgaccttcctgctgtcggaggatggcagcgggaaaggg
gcagcgctcatcacagccgtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system