KEGG   Serinus canaria (common canary): 103824025Help
Entry
103824025         CDS       T05755                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103824025 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:scan03036]
    103824025 (SETDB1)
Enzymes [BR:scan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103824025 (SETDB1)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103824025 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103824025 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET TUDOR_5 Tudor_4 Pre-SET MBD DUF4537 XkdW YkyA
Motif
Other DBs
NCBI-GeneID: 103824025
NCBI-ProteinID: XP_018779827
LinkDB All DBs
Position
Unknown
AA seq 1285 aa AA seqDB search
MDCQDIKELQQEVMEELGISMEELQEIIDKEVENSEWVRQRKQQLEELEQCMRHKEEEVA
HVDQLIDDAVRAMDKCEMLAKELYSMMGLQYRESSSEDEAPTATEVIEIPDEEDDDVMSV
DSGWKRSSSTPRISRDQSLLREAMAAMRKSARDVAKFMDAVNKKTNLQEAQKDAQPPQEP
PGTAQPITVPAAPSNDLNTDGDLKVGMRILGKKRTKTWHKGTLIAIQTVGAGKKYKVKFD
NKGKSLLSGNHIAYDYHPSAERHHVGRRVVARYKDGNQMWLYAGIVAETPNVKNKDRFLI
FFDDGYASYVKEWELYPVCRPLKKAWEDIEDVSCRDFIEEYITAYPNRPMVLLKNGQLIK
TEWEGTWWKSRVEEVDGSLVKILFLEALPMGTASVSFSFPHEDKRCEWIYRGSTRLEPMF
SMKASTASTQEKKQSGQTRTRPNVGAVRSKGPVVQYTQDLAGAGPQYKTPEPAAHPTSPQ
PAEMECSDTQLAQGRKQVAKKSTSFRPGSVGSGHSSPSSPVLGDTPAAGRALPAPQHRIP
SSVPSQPFHGMMDRVPNEPSYRAPLEKLFYLPHVCSYACLARVRPVRSDQYRSRNPLLIP
LLYDFRRMTARRRVNRKMGFHVLYKTPCGLCLRSMHEIERYLFETDCDFLFLEMFCLDPY
VLVDRKFQPYKPYYYIADITKGKEDVPLSCVNEIDNTPPPQVAYSKERIPGKGVYINTSW
EFLVGCDCKDGCRDKSKCACHQLTIQASGCTPGGQINPNSGYQHKRLEECLPTGVYECNK
RCKCNVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFAD
KEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDNSGVDLKDDDDDEENTGTEELEES
NEDSSDDNFCKDENFNTSSVLRSYATRRQTRGQRDHGSSETVSKDSGLTRPLGHEEPPTA
PPCKLPVSEEISKNKVASWLSSNSVAESLHDSDGASSFRVGEGGETKAVKMEMPAEREKG
CASTLPGDLNGEAKAPKKEEPEESTKIPGLSSLGRRYGYNPCPPRLEGIRRPVSGTVLLQ
SRRRSLAPPPTPENVLMVSSSTDSEEEPRAGQAPGTANDSDDIQTISSGSEEEEGEDKKN
PSSGSGPVKRQVAVKSTRGFALKSTHGIAIKSTPLAAADKGESAGPVRRSTRQFYDGEEN
CYIIDAKLEGNLGRYLNHSCTPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYN
YEVGSVEGKELLCCCGAIDCRGRLL
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaggacatcaaggagctgcagcaggaggtgatggaggagttgggaatctcc
atggaggagctgcaggagatcatcgacaaagaagtggagaattccgagtgggtgaggcag
cggaagcagcagctggaggagctggagcagtgcatgaggcacaaggaggaggaggtggcc
cacgttgaccagctcattgatgatgctgtgagggccatggacaagtgtgagatgctggcc
aaggagctgtactccatgatgggcctgcagtaccgggagagcagctcggaggacgaggct
ccaacagccacggaagtgatcgagatccccgacgaggaggatgacgatgtcatgagcgtg
gactcaggctggaaacgcagcagcagcactcccagaatctccagggatcagagtctgctg
agggaagcaatggctgccatgaggaaatctgcccgggatgttgcaaaattcatggatgct
gtaaacaagaaaaccaacttgcaggaagcacagaaagatgcacaaccccctcaggaacct
cctggcactgcccagcccatcactgtccctgcagcccctagcaatgatctcaacactgat
ggggacctcaaagtgggcatgaggattttggggaaaaaaagaaccaagacgtggcacaag
gggacgttgattgccatccagacagttggtgctggcaagaaatacaaagtgaaatttgat
aacaaagggaagagtttgctctcgggcaaccacattgcctacgattaccacccatctgct
gagaggcaccacgtgggcaggagggtggtggccaggtacaaggatggcaatcagatgtgg
ctctatgctgggatcgtggctgagacccccaatgtcaagaataaagacaggttcctgatc
ttcttcgacgacggctacgcgtcctacgtgaaggagtgggagctgtacccggtctgccgg
ccactgaaaaaagcctgggaagacattgaggatgtttcctgtcgggatttcattgaggaa
tacatcactgcctaccccaaccggcccatggtactgctgaagaacgggcagctgatcaaa
actgagtgggaaggcacctggtggaaatccagagtggaagaagtggatggaagtctggtg
aaaatccttttcctggaagctcttcccatgggaactgcaagtgtttccttctccttccca
cacgaggacaaacgttgtgagtggatttacagaggttccacacgcctcgagcccatgttc
agcatgaaagcttccacagcttccacccaggaaaagaagcaaagtgggcaaaccaggact
cgtcccaacgttggtgctgtgaggagcaagggccctgtggtccagtacacccaggattta
gcaggagctggtccccagtacaagactccagagccagctgcacatcccacgtctcctcag
cctgcagagatggaatgctcggacacccagctggcccagggcagaaagcaggtggccaag
aaaagcacttccttccgtcctggctccgtgggctccggccactcgtccccatcctcccct
gtcctcggggacaccccagcagctgggagagccctcccagccccgcagcaccgcatcccc
agcagcgtcccctctcagcccttccacgggatgatggaccgtgttcccaacgagccatcc
tacagagcccctctggagaaactcttctaccttccccacgtgtgcagctacgcctgcctg
gcgcgggtgcggccggtgcgcagcgaccagtaccgcagccgcaacccgctgctcatcccg
ctgctctacgacttccgccgcatgacggcgcggcgccgcgtcaaccgcaagatgggcttc
cacgtgctctacaaaacgccctgcgggctctgcctgcgctccatgcacgagatcgagcgc
tacctcttcgagacggactgcgacttcttgttcctggagatgttctgcctggatccctac
gtgctggtggatcgcaagttccagccctacaagccttactactacatcgccgatatcacc
aagggcaaggaggacgtgcccctgtcgtgcgtcaacgagatcgacaacacgccgccgccg
caggtggcctacagcaaggagaggatccccgggaaaggggtgtacatcaacaccagctgg
gagttcctcgtgggctgtgactgcaaggatggctgcagggacaaatccaagtgtgcctgt
caccagctgaccatccaggccagtggctgcacgccaggagggcaaatcaaccccaactca
ggctaccagcacaagcggctggaggaatgtcttccaacaggtgtttatgagtgcaacaag
aggtgcaagtgcaacgtgaacatgtgcaccaaccgcctggtccagcacggcctccaggtg
cggctgcagctcttcaagacccagaacaaaggttggggcattcgctgcctcgatgacatc
gccaagggctcctttgtctgcatctacgcagggaaaatcctgacagatgacttcgctgac
aaagaggggctggagatgggtgatgagtactttgccaacctggaccacatcgagagcgtg
gagaacttcaaggagggctacgagagcgacgccaagtgctcctcggacaacagcggcgtg
gacctcaaggacgacgacgacgacgaggagaacacgggcacggaggagctggaggaatcc
aacgaggacagctccgatgacaacttctgcaaggacgagaacttcaacaccagctcggtg
ctgcgcagctacgccacgcgccggcagacgcgcggccaacgcgaccacggctcctcggag
acggtctccaaggactcggggctgacgcggcccctcggccacgaggagccccccacggcc
cctccctgcaagctgcccgtgtctgaggagatctccaagaacaaagtggcctcgtggttg
agctccaacagcgtggctgagagcttgcacgacagcgatggcgcctcgtccttcagggtg
ggtgaagggggggaaaccaaggctgtgaagatggagatgcctgcggagagggagaagggc
tgtgcttccacacttccaggagatctgaatggagaggcaaaggcacccaagaaggaggaa
cctgaagaatcaaccaaaattcctgggctgagcagcctgggaaggaggtatggctacaac
ccctgccctcccaggctggaggggatccgcaggcccgtcagtggcacggtgctgctgcag
agccgccggcgatccctggccccaccgcccaccccagagaatgtgctgatggtgtcgagc
agcaccgacagcgaggaagagcccagggcagggcaggccccgggcacagccaatgacagc
gacgacatccagaccatttcctcaggatccgaggaggaggaaggggaggacaagaaaaat
ccatcatctgggtcaggtcccgtgaagagacaggtggctgtgaaatccacccgaggtttc
gccctgaaatccacccacggcatcgccatcaaatccacgccgctggcggcggccgacaag
ggcgagagcgcggggccggtgcggcgcagcacgcggcagttctacgacggcgaggagaac
tgctacatcatcgacgccaagctcgagggcaacctgggccgctacctcaaccacagctgc
accccaaacctcttcgtgcagaacgtcttcgtggacacccacgaccttcgcttcccttgg
gtcgccttctttgccagcaagaggatccgagctggcacggagctgacctgggattacaac
tacgaggttggcagcgtggaggggaaggagctgctgtgctgctgcggggccatcgactgc
cggggccggctgctctga

DBGET integrated database retrieval system