KEGG   Serinus canaria (common canary): 103824088Help
Entry
103824088         CDS       T05755                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103824088 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:scan03036]
    103824088 (KMT5B)
Enzymes [BR:scan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103824088 (KMT5B)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103824088 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 103824088
NCBI-ProteinID: XP_009097539
LinkDB All DBs
Position
Unknown
AA seq 854 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHAQTKLQHAGKENPKTGKNGVERRSSRCSSASGFEG
QSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFK
KDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTCE
RRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKGNATNRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKPAK
PLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAVSS
GCLTRHAAREHKLNSVKGAYEHGDIAPCTYITRRSMRTRMSLKETSDTKLEPNTLDSYKS
NLTGTQSDIAEQQSRALNDNNVAHGPSHKGEGRCQKSDAGTSRKKSRQGKLVKPSSKTEE
TDTMHNTPMKDEVPDLISSHSELEERNNVVDTPVGFKDCIPGSGGCSVTTDNFKAKDSFR
TAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKLSKD
HEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREDENRGTYPEDLHENGVCCSETLSLLE
SRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSIDIDI
SSRRREDQSLRLNA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtagtgaatggccggagaagtggaagcaag
tcatctaatgaccacgcacagaccaaattgcagcatgcaggaaaggagaatccaaagacg
ggcaaaaatggagttgagagaagatcaagcagatgtagcagtgcttcaggatttgaggga
caaagtcgttatgtgccttcctctggaatgtctgccaaggaactctgtgaaaatgatgac
ctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatgaatact
agatttcgacctattaaaggaaggcaagaagagctcaaagaggtgattgaacgttttaag
aaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcccggcac
tattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtatttatttat
ttacgaatgtttgcaactgacagcgggtttgagatactgccttgtaatcggtattcttct
gagcaaaatggagccaaaattgttgcaacaaaagaatggaagcgaaatgataaaatagaa
ttacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctgagacat
ggggaaaatgacttcagtgtcatgtattccacacgaaaaaactgtgcacaactatggctt
ggtcctgctgcatttatcaatcatgattgcagacctaactgtaagttcgtatcaacaggc
agagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatctcttgt
tattatggagatgggttttttggagaaaacaatgaatactgcgagtgttacacctgtgaa
agacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcctgtgatt
aacagtaaatatggactgagagaaacagacaaacgattgaacagacttaaaaagttgggt
gacagcagcaagaattcagacagccagtctgtcagctctaacactgatgcagataccact
caggaaaaaggtaatgcaactaacagaaaatcttcaattggcgtaaaaaagaacagcaaa
aatagaacattaaccagacagtctatatcaagaattccagcatcatcaaactctacctca
tctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcctgcaaag
cctttactttcaaagataaagttgagaaatcagtgcaaaaggccagagcaaaagaatgct
tctcgaaagcttgaaatgggaaatttagttctcaaagagcctaaagtagttttgtataaa
aacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtctctagc
ggatgcttaacgaggcatgcagcaagagaacataaactgaattctgtgaaaggtgcttat
gagcatggtgatattgcaccctgcacatacatcacaaggaggtcaatgagaacaaggatg
agtttgaaggagacctctgacacaaagcttgaaccaaatacattggatagctataagagt
aacttgactggaacacaatcggacattgcagagcagcagtctcgtgcgttaaatgacaac
aatgtggctcatggaccatcacataaaggagagggtcggtgccagaaaagtgatgcaggc
acatcaagaaagaaatctcgacaaggaaagcttgtgaaaccatcttcaaaaacagaggaa
actgatactatgcacaacacgcctatgaaggatgaagtaccagatttgattagttctcat
tcagaactcgaagagaggaataatgtggtggacacacctgttgggtttaaagactgtatc
cctggatctggtggctgctctgttacaactgacaattttaaagcaaaagacagctttaga
actgcaaaaagtaaaaagaaaagacgaatcacgaggtatgatgcacaacttatccttgaa
aatagctctgggatccctaaactgactcttcgtcggcgccatgatagcagtagcaaggca
aatgatcaagagagtgatggaatgaattcttcaaaaataagcataaaattaagtaaagac
catgaaaaagataataatttatatgtagcaaagctaaataatgggtttaactcaggatca
ggcaatagttcaacaaaattaaaaatacagctaaaacgagaggacgaaaacagagggaca
tacccagaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcccttttggag
tcgagaatggaagtagatgattatggtcactatgaagaggaaacagcagatgaatcttca
tcagaagaggacgatgaagaggaagatgactatgatgatgaatttgatgactttattcct
cttcctccagcaaagagattaaggcttattgttggcaaggattcaatagatattgatatt
tcttccaggaggagagaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system