KEGG   Serinus canaria (common canary): 103825056
Entry
103825056         CDS       T05755                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
scan  Serinus canaria (common canary)
Pathway
scan04080  Neuroactive ligand-receptor interaction
scan04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103825056 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103825056 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:scan04030]
    103825056 (LPAR2)
G protein-coupled receptors [BR:scan04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103825056 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 103825056
NCBI-ProteinID: XP_009098604
LinkDB
Position
Unknown
AA seq 330 aa
MLWNFLDFSWIFELSSHWRPRDLLLLALGLALSALVLLTNLLVIAAVATNRRFHHPIYYL
LANLAAADLFAGVAYMFLMFHTGPRTAGLSLKTWFVRQSLLDTSLSASVVNLLAIAVERH
RTVLTMQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYGWHCLCSLESCSRMAPLYSRSYL
TFWAVSNLVVFLVMVVVYGHIFVYVRRRMARMAQHTGAHPRHRDTVMALVKTVTIILGAF
VVCWTPGQVVLLLDGLGCQSCDVLAVEKYVLLLAEINSLINAVVYSWRHQEMRGTFRRLL
CFPCARHAKYARPERGLRSHHGHFTVDSSI
NT seq 993 nt   +upstreamnt  +downstreamnt
atgttatggaatttcctggatttttcatggatttttgagctgagctcgcactggcgcccg
cgggacctcctgctgctggcgctggggctggcgctcagcgccctggtgctgctcaccaac
ctgctggtcatcgccgccgtggccaccaaccgccgcttccaccaccccatctactacctg
ctggccaacctggccgccgccgacctcttcgccggcgtggcctacatgttcttgatgttc
cacacggggcccaggacggccggtttgtcgctcaagacgtggttcgtccgtcagagcttg
ttggacaccagcttgagcgcttcggtggtcaacctgttggccatcgcggtggagaggcac
cggacggtgctgaccatgcagctgcacagcgagatgtcggcgcagcgcgtggtggggttg
atcttctccatctgggcggcggcgttgctgctggggttgatcccgtcctacggttggcac
tgcctctgctccttggagagctgctccaggatggcgccgctctacagccgcagctacctg
accttctgggccgtctccaacctggtggtcttcttggtcatggtggtggtctacgggcac
atcttcgtctacgtcaggaggaggatggcgcgcatggcgcagcacaccggggcgcacccg
cggcaccgtgacaccgtgatggcgctggtcaagaccgtcaccatcatcctgggtgccttc
gtggtgtgctggacgccgggccaggtggttctgctgctggacgggctgggctgccagagc
tgcgacgtgctggccgtggagaagtacgtgctgctgctggccgagatcaactcgctcatc
aacgccgtggtttactcgtggcgccaccaggagatgcgcggcaccttccgccgcctgctc
tgcttcccctgcgcccgccacgccaaatacgcccgccccgagcgcggcctccgctcccac
cacggccacttcaccgtcgactcctccatctag

DBGET integrated database retrieval system