KEGG   Serinus canaria (common canary): 103825217
Entry
103825217         CDS       T05755                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04020  Calcium signaling pathway
scan04144  Endocytosis
scan04510  Focal adhesion
scan04540  Gap junction
scan04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103825217 (PDGFRA)
   04020 Calcium signaling pathway
    103825217 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103825217 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103825217 (PDGFRA)
   04540 Gap junction
    103825217 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103825217 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103825217 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:scan04090]
    103825217 (PDGFRA)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103825217 (PDGFRA)
Protein kinases [BR:scan01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103825217 (PDGFRA)
CD molecules [BR:scan04090]
 Proteins
  103825217 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Adeno_E3_CR1 Kinase-like
Other DBs
NCBI-GeneID: 103825217
NCBI-ProteinID: XP_009098751
LinkDB
Position
Unknown
AA seq 1087 aa
MGTYPRTFLILGCFLTGPLLTFCQLPLPTIVPNRNEMVVQLYSNFTLKCSGDSEVSWQYP
VTEGNHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQEEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPAVIPCRTSDPEAQVTLVNSLDKPVHALYDTKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYIIRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTAGHATKEVK
ENKKVAITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTTSGRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALISAL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCNNDTSWTLLTNNISDIHMEVHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttacccacggacgttcctgatcctgggatgttttctcacaggaccactccta
acattttgccagcttcctctgccaactattgttcccaataggaacgaaatggtggtacag
ctgtattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtaccca
gtgaccgagggaaaccaccggatagacattagacacgaagagaacaacagcggcctcttt
gtgacagtgctcgaagtagggaatgcctcggccgcccatacggggctgtatgtctgctat
tataaccacacacaggaggaggatggcgaggtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctggtagaa
gaaggtgatcctgcagttatcccttgtcggaccagtgacccagaggctcaagtgacttta
gttaacagtttagacaagcctgtgcatgctttatatgacaccaagcaaggcttcataggg
aattttcctgcgggctcatacacgtgcaaaacaatggtgaaaggtgtggagttcaagtct
gatgagttcctcatctatattataagagctacttcacaactgcctgttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggtcaatttacaatggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtgccatcacagaagctggtttacaccctgaccattcctgaggca
tccgtgaaagacacaggggattatgaatgtactgctgggcatgcaaccaaggaggttaag
gaaaataagaaagtagccattacagttcatgacaaaggctttgttcacctggagcctcag
ttcagccctctggaagctgtcaacctacatgaagtcaaaaactttgttgttgatgtgcag
gcttaccctgcaccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
acagagattgttactacttcaggaagagtccaggaaacaaggtttcagagtattttaaaa
ttgatacgggccaaggaggaagacagtggatactatactttggttgctgaaaatgaagat
gagattaaaagatacaccttctcattgctaatacaagttccagctctgatctcagccctc
gtggatgatcaccatggctctgcaggtgggcagactgtgagatgcttggcagaggggacc
ccacttcccgatgtggaatggctggtttgcaaggacattaaaaagtgcaacaatgacacc
tcatggacccttttgactaacaatatctctgatatccacatggaagtccacctggatgag
aaaaacatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgacctcggtgctgttactcgagaactgaagcttgtggctcccacc
ttgagatcagagctaactgtggctgctgctgtcttggtgctgttagtgattgtgataatt
tccctgattgtcctggtcatcatatggaaacagaagcccaggtatgagattagatggaga
gtcattgagtctatcagccctgatggccacgagtacatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcggatccttggt
tcgggtgcctttggaaaagtcgttgaagggactgcatatggattgagtcgctctcagccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttggccctcacttgaatattgtgaatctg
ctcggagcttgtacaaaatcaggtcctatttacatcattactgaatactgtttttatggc
gatttggtgaactacctgcacaagaatagggacaatttcctgaaccgacaccccgaaaag
cctaaaaaagatttggatatctttgggatgaaccctgctgatgaaagcacaagaagttat
gtgatactatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggctctaaatactctgatattcagagatct
gtgtatgatcggcctgcttcgtataagaagaaatccatgtcagaatcagaagtcaaaaat
cttctttcagatgacagttcagagggcctcagcctattggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggcc
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagtactttcctcccagtaaaa
tggatggcacctgaaagtatttttgacaacctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccgtatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccgaatggccaaacccgaccat
gccaccaatgaagtgtatgagattatggtgaagtgctggaacagtgaaccggagaaaaga
ccttctttctaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcatctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtcacttacaagaatgaagacaagctaaag
gacagggagagtggatttgacgagcagaggctgagtgctgacagtggatacatcattccc
ctgcctgacattgaccctgtttctgaggatgagcttggcaaaagaaacagacacagttca
cagacatctgaagaaagtgccattgaaactggttccagtagctctaccttcatcaagagg
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtga

DBGET integrated database retrieval system