KEGG   Serinus canaria (common canary): 103825927Help
Entry
103825927         CDS       T05755                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
scan  Serinus canaria (common canary)
Pathway
scan00020  Citrate cycle (TCA cycle)
scan00190  Oxidative phosphorylation
scan01100  Metabolic pathways
scan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103825927 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103825927 (SDHA)
Enzymes [BR:scan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103825927 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 103825927
NCBI-ProteinID: XP_009099409
LinkDB All DBs
Position
Unknown
AA seq 667 aa AA seqDB search
MAVAAAAARGLAKRWLRPAAASRAWPAACQAPARNLHFTVYGKKNISTKVSDSISTQYPV
VDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDD
NWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQS
LQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIAL
CIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHP
TGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGC
GPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNY
KGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIASTCKP
GEPVPPIKPNAGEESVANLDKLRFANGSIRTSEVRLNMQKAMQNHAAVFRTGSVLQEGCE
KLSQIYGDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDY
KLRVDEYDYSKPLQGQQRKPFEEHWRKHTLSYVDIPTGKVTLKYRPVIDKTLNEQDCQTV
PPAIRSY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcggcagcggctgcgcgggggctggcgaagcgctggctgcgcccggccgcg
gcttcccgggcgtggccagcagcatgccaggctcccgcacggaacttacacttcacagtc
tatggaaagaaaaacatctccacgaaggtgtctgactcgatttctacacaatacccagta
gtggaccatgagtttgatgcagttgttgtgggtgcaggaggagcaggcctgcgggctgcc
tttggtttgtcagaagctgggtttaacacagcctgtgttaccaagctgttccccactcgc
tctcatactgttgctgcacagggaggtatcaatgctgctctggggaacatggaggatgat
aactggaggtggcatttctatgacacagtgaaagggtcggactggctgggtgaccaggat
gccatacactacatgactgagcaagccccagctgcggtgatagagctggaaaattatggg
atgccgttcagcagaactgaagaaggaaaaatctatcagcgtgcatttggtggacagagt
cttcagtttggaaaaggaggacaggcccacagatgctgttgtgttgcagacaggactgga
cattcactcttacatactctgtatggcaggtctcttcgatatgatacaagctactttgtt
gaatattttgccttggacttacttatggagaatggagaatgccgtggtgtaattgccctc
tgcattgaagatggaaccatacatcgttttagagcaaagaacacggtcattgccactggt
gggtatggccgcacgtacttcagctgcacatctgctcataccagtactggtgatggcact
gccatggtcacacgagctgggctcccttgccaggacttagaatttgtgcagtttcaccct
acaggtatctatggggctggctgccttatcacagaaggatgtcgtggagaaggaggtatt
ctgatcaacagtcaaggtgaaagattcatggagagatatgcacctgttgccaaggatctg
gcttccagggatgtcgtgtctcgttctatgacgatagaaatccgtgaaggaaggggttgt
ggtcctgaaaaggaccatgtgtacttgcagttgcaccacttgccaccacagcagctggcc
acccgtctcccagggatttccgaaacagccatgatattcgctggagttgatgtcactaaa
gagcctatccctgtcttgcctactgtgcattataatatgggaggtattcctactaactac
aagggacaggtgatcacacacgtgaatggtgaggataaggtggtgcctggcttatacgcc
tgtggggaagcagcctctgcatccgtccatggcgcaaatcgcctcggagcaaactccctt
ctggatttggtggtcttcggtcgtgcttgtgccctgactattgcaagtacatgcaagcct
ggagagccagttccccccattaaaccaaatgctggtgaagagtcagttgctaatcttgac
aagttaaggtttgctaatggaagcataaggacttcagaagtgcgacttaacatgcagaag
gcaatgcaaaaccatgctgctgtatttcgtactggttctgtactccaagaaggctgtgag
aagcttagccagatttatggtgatctggctcatctaaagacttttgacagaggtattgtg
tggaacactgacttggtggagaccctcgaactgcagaacctgatgctttgtgctctacaa
actatttatggtgctgaggctcgcaaagagtcccggggtgcccatgccagagaggattat
aagttacgggtggatgagtatgactattctaagccactccaaggccaacagcggaagcca
tttgaggagcactggagaaagcacacgctgtcatatgtggatatcccaactgggaaggtt
accttgaagtacagaccagtgatcgacaagactttgaatgagcaagattgccagactgtc
ccaccagcgatccgctcatactag

DBGET integrated database retrieval system