KEGG   Serinus canaria (common canary): 103826036Help
Entry
103826036         CDS       T05755                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin-5 isoform X1
  KO
K17345  tetraspanin-5
Organism
scan  Serinus canaria (common canary)
Brite
KEGG Orthology (KO) [BR:scan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scan04147]
    103826036 (TSPAN5)
Exosome [BR:scan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103826036 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 103826036
NCBI-ProteinID: XP_009099541
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaagcactacaaggggcctgaagtcagttgttgcatcaaatatttcatcttt
ggcttcaatgtcattttctggttccttggcatagcatttcttgggattggattgtgggca
tggaatgaaaagggagtgctgtccaacatctcctccattactgacctgggaggctttgat
cctgtttggctcttcctagtggtaggaggagttatgttcattttgggattcgcaggatgc
attggagctttacgagaaaacacttttcttctcaaatttttctctgtatttcttgggatt
attttcttcttggagctcactgctggtgttctagcatttgttttcaaagactggataaag
gaccagctgtatttctttataaacaacaacatcagagcgtaccgagatgacattgattta
caaaacctcatagacttcacacaggaatattggcagtgctgtggggcttttggagctgat
gactggaaccttaatatttacttcaattgtacagattccaatgcgagccgagagcgctgt
ggcgtgccattctcttgctgtactaaagaccctgctgaagatgttattaatactcagtgt
ggctacgatgcaaggcaaaaaccagaagttgatcagcagattgttatctacactaaaggt
tgtgtccctcagtttgagaaatggttgcaggacaaccttaccatagttgctggtatattc
attgggatagcattgctgcagatatttgggatatgcttagcccagaatttggttagtgac
attgaggctgtcagagccagctggtaa

DBGET integrated database retrieval system