KEGG   Staphylococcus capitis: AYP1020_0454Help
Entry
AYP1020_0454      CDS       T03970                                 

Definition
(GenBank) gram-positive signal peptide, YSIRK family
Organism
scap  Staphylococcus capitis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: AKL91602
LinkDB All DBs
Position
complement(439659..442349)
Genome map
AA seq 896 aa AA seqDB search
MNKPNNFSNDKPTQKNHYSIRKFTVGTASIIVGSFLFFGQAHAEEGTGGNTWQREAVGTV
NTAGQPSTTSQDQNNQAGTGTPAATQTGQDGAKTNTADHQGQGTAEATGTQTNQADATQT
NPSPNTTGQDNQATSTPQGTQTAGTGQTAPTTATGDTQAKPHAETADQGNGATVTPSPQN
DATSPAASTKPEATTGQDATSKPGTTENNSTGQGAQAGTVGAGTPTPSQPETQPNTDTTG
SAKPSTSTTDQEKPNTEDHGEQTGTSAGNAQNAAGTPGETKPNQATPAPNNQDTQPGNTN
NGAATTPQPGTTGQDTQGTQSKPGTTETGTAQNTGTTDTQAKPEASNQNAGTTVTPPADK
DNQAGQGTAGTAGTPAPDTNNGATGTPGTTAPENNNQAGQGTASTAGTPTPESNNGATGT
PGQTTPNGQDNQEKPSAPGTDQQGQDTPQTGTPGQGTQTGENGTGTTVTPSPNQNQAGNE
NQTKPGTDNNAGVTTPDQGTAPKPGTDQNPGTDTPDQNNQAEQGTTGTTGTPGQGTQTGE
NGAGTTVTPSPDQNTEVKPNDNGVAKPDTNNNAGATTPDQGTDTDQKPGTNTPDQNNQAG
QGTTGATGTPAPDTNNGSTGTPGQTTPSGQDNQEKPSTPGNENQEKPDTNNAEQAKPTTP
EQNGQLGAGVKPGTANPDQNTEVKPNENGNTKPGTVTPDQNNQAGQGTTGTTGTPAPDTN
NGSTGTPGQTTPSGQDNQEKPDTNNNGQAKPTTPEQNGQLGAGVKPGTANPDQNTEVTTP
NENGNPKPGTVTPDQNNEPTGAQTGGDKGGQTGGDTGRNTGEDKGGQTGGDTGNTDSDNK
QTVVNDEVKTSNGSKDKSELPETGLSNESDYATTVFGTLSLAASLLLLRRQRKESK
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacctaacaatttttcaaatgacaaacccactcagaaaaatcactattcaatt
agaaaattcacggttggtactgcttctattattgtaggttcattccttttcttcggacag
gcacatgctgaagaaggcacgggaggtaatacttggcaaagagaagctgtaggtaccgtt
aacacagctggtcaaccgagcactacaagtcaagaccaaaataatcaagctggtactggt
actcctgctgctacacaaacaggtcaagatggagctaaaacaaacactgccgaccaccaa
ggtcaaggcactgcagaagctacaggaactcaaactaatcaagccgatgctacacaaaca
aaccctagtccaaatactaccggacaagataaccaagctactagtactccacaaggaact
caaactgctggcacaggtcaaactgcgccaactacagctactggagatactcaagctaaa
cctcatgctgaaacagcagatcaaggtaatggagctactgtgactcctagtcctcaaaat
gatgcaacttccccagcagcttcaacaaaaccagaggcaacgactggtcaagatgctaca
tctaaaccaggtactactgaaaacaatagtactggtcaaggtgctcaagctggtactgta
ggtgctggaacacctactccatctcaacctgaaacacaacctaatacagacactacaggt
tcagctaaaccaagtactagtactactgatcaagagaaacctaatacagaagatcatgga
gaacaaacaggtacttcagctggtaatgctcaaaatgctgcaggtactcctggcgaaact
aaacctaatcaagctacacctgctccaaacaatcaagatactcaaccaggtaatactaat
aatggtgctgccacaactccacaacctggaactacaggacaagatactcaaggtactcaa
tctaaacctggtacaactgaaacagggacagctcaaaatacagggactacagatacacaa
gctaaacctgaggctagcaatcaaaatgcaggaactactgtgactccacctgctgataaa
gataatcaagctggacaaggtactgcaggcactgcaggaactcctgctcctgatactaat
aacggtgcaactggtactcctggaactactgcacctgaaaataacaaccaagctggacaa
ggtactgcaagcactgcaggaactcctactcctgaaagtaataacggtgcaactggtact
cctggtcaaacaacaccaaatggtcaagataatcaagaaaaaccaagcgctcctggtact
gatcaacaaggtcaagacacacctcaaacaggtactcctggtcaaggtactcaaacgggt
gaaaatggtacaggcactactgtaacgccttctcctaatcaaaaccaagctggtaatgaa
aaccaaactaaaccaggtactgataacaacgctggggttactactcctgaccaaggtact
gcacctaaacctggcactgatcaaaatcctggaacagatactccagatcaaaacaaccaa
gctgaacaaggcactactggtactacaggtactcctggtcaaggtactcaaacgggtgaa
aatggtgcaggcactactgtaacgccttctcctgatcaaaatactgaagtaaaacctaat
gacaatggtgtcgctaaacctgatactaacaataatgctggtgctactactcctgaccaa
ggtactgacactgatcaaaaacctggtacaaatactccagatcaaaacaaccaagctgga
caaggcactactggtgctacaggaactcctgctcctgatactaataacggttcaactggt
actcctggtcaaacaacaccaagtggtcaagataatcaagaaaaaccaagtactcctggt
aatgaaaatcaagaaaaaccagatactaataatgctgaacaagctaaacctactactccg
gaacaaaatggacaattaggtgctggtgttaaacctggtacagctaatcctgatcaaaat
actgaagttaaacctaatgaaaacggtaatactaaacctggtacagttactcctgatcaa
aacaaccaagctggacaaggtactactggtactacaggaactcctgctcctgatactaat
aacggttcaactggtactcctggtcaaacaacaccaagtggtcaagataatcaagaaaaa
ccagatactaataataatggacaagctaaacctactactccggaacaaaatggacaatta
ggtgctggtgttaaacctggtacagctaatcctgatcaaaatactgaagtaacaacacct
aatgaaaacggtaatcctaaacctggtacagttactcctgatcaaaataacgagcctaca
ggtgctcaaactggtggagacaaaggtggtcaaactggtggagacactggacgaaatact
ggtgaagacaaaggtggtcaaactggtggagacactggcaacactgatagtgataacaaa
caaactgttgttaatgatgaggtaaaaacttcaaatggttcaaaagataaatctgaatta
ccggaaactggattaagcaatgaatcagactacgctactactgtattcggtacactatct
ttagctgcatcattattactattaagaagacaaagaaaagaatctaaatag

DBGET integrated database retrieval system