KEGG   Staphylococcus capitis: AYP1020_0526Help
Entry
AYP1020_0526      CDS       T03970                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scap  Staphylococcus capitis
Brite
KEGG Orthology (KO) [BR:scap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scap01001]
    AYP1020_0526 (prkC)
Enzymes [BR:scap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AYP1020_0526 (prkC)
Protein kinases [BR:scap01001]
 Serine/threonine kinases: Other
  Bacterial family
   AYP1020_0526 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal RIO1 Kinase-like Kdo Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AKL91673
LinkDB All DBs
Position
515821..517824
Genome map
AA seq 667 aa AA seqDB search
MIGKMVNERYKVIDKLGGGGMSIVYLAEDTILNRKVAIKAISIPPREKEETLKRFEREVH
NSSQLSHENIVSMIDVDEEDECFYLVMEYIEGPTLAEYIHSHGPLSVETAIKFTEQILSG
IKHAHDMRIVHRDIKPQNVLIDKNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYLSPEQ
AKGESTDEGTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSIPNITTDKREEVPQA
LSNVVLRATEKDKHNRYHTVQEMCDDLTSALHENRANEEKYELDKTKTVPLTKDELNKKI
NDTHNDDDLNKTMQIPIVNEPVRQQEFQSLEGRYSPPPKKKHSKMKITVLSLIFALLLAG
LVGFIGMGVFGSKYEEMPDLSGKTEKEAEQILKDHHLTMGDISRKYSDKYPENQIIKSEP
NSGERVEEGEAIDIILSKGPQKVKMPNLVGLPKDEAVKKLKNLGLKDIDVEQAYSHSVDK
GLISEQSVEANSEVALNDHHIKIYESLGVRQVYVSDFENKSYSSAKKELESKGFKVQATQ
ENDDKVKKGNIISQSPKNKSVDEGSIINLTVSKGKSGEDDDDSDDSDVKSTSETVKVPYS
GSKGKSQTVEVFIRDKDNSGNSASQTFKITKDKTISIPLKIEKGKTAGYTVRVDNKIVAD
KDVGYDD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaagatggttaatgaacgctacaaagtaattgataaacttggtggcggagga
atgagtattgtatatttagcagaagatacaatacttaatcgtaaagtcgcaataaaagct
atttctattccacctcgtgaaaaggaagaaaccttaaaacgctttgaacgagaggtacat
aattcttctcagctatcacatgaaaatatagtgagtatgattgatgtagatgaagaagat
gaatgtttctacctagtaatggaatatattgaaggccctacattagctgaatatatacat
agtcatggtcctctaagtgtagaaacagcaataaaatttaccgagcaaattttaagtggt
atcaaacacgcacatgatatgagaattgtgcatcgtgacattaaaccacaaaatgtatta
atagataaaaacaaaacattgaaaatctttgattttggtatagctaaagcgctgagtgaa
acatccttaacacagacgaatcacgtgctcggaacagtacaatatctttcaccagaacag
gcaaaaggtgaatcaactgatgaaggtacagatatttactctattggtatagtgctatat
gaaatgttagtaggtgaacctccgtttaatggagaaactgctgttagtattgccattaag
catattcaagattcaataccaaatattactactgataaacgcgaagaagtaccacaagcg
ttaagtaatgttgtgctacgcgctactgaaaaagataaacataatcgttatcataccgtt
caagaaatgtgtgatgacttaacgagtgctttacatgagaaccgtgcgaacgaggaaaaa
tatgaactagataaaactaaaacagttccgctcactaaagatgaactcaataaaaagata
aatgatactcataacgatgatgatttaaataaaacaatgcaaatccctattgttaacgaa
cctgtacgtcagcaagaatttcaatcgttagaaggtcgctattcaccaccacctaagaag
aaacactctaagatgaaaatcactgtcctatctttaatatttgcgttattgttagcggga
ttagttggttttataggtatgggagtttttggtagtaagtatgaggaaatgccagattta
tcaggaaaaactgaaaaagaagcagagcaaatattaaaggatcatcatttgaccatgggt
gacatatctaggaaatatagtgataaatatcctgaaaaccaaatcatcaaatctgaaccc
aatagcggtgaacgggtagaagaaggagaagcgattgatattattctttctaaaggtcct
caaaaagtaaaaatgccaaatctcgtaggactgcctaaagatgaagcagttaaaaagctg
aaaaatttaggtttaaaagatattgatgttgaacaagcttatagtcactcagtagataaa
ggtttaatttcagaacaaagtgttgaagcaaatagtgaagttgctctaaatgatcatcac
attaaaatctatgagtcactaggtgtgcgtcaagtttatgtgagtgattttgaaaataaa
tcttattcatcagccaaaaaagagttggaatctaaaggatttaaagtacaagctactcaa
gaaaatgatgataaagttaaaaaaggaaatattatatctcaatcacctaaaaataaatct
gtagatgaaggttctataattaatttaacagtttcaaaaggcaagtcaggtgaggacgat
gatgacagtgatgatagcgatgtgaaatcaacgtctgaaacagttaaagtgccctactca
ggtagtaaaggtaaaagccaaacagtagaagtctttataagagacaaagataactctgga
aattccgcatctcaaacttttaaaattactaaggataaaacaataagcatacctttaaaa
atagaaaaaggtaaaactgcgggatacactgtacgtgttgataataaaattgttgccgat
aaagatgttggctacgatgactaa

DBGET integrated database retrieval system