KEGG   Staphylococcus capitis: AYP1020_0610Help
Entry
AYP1020_0610      CDS       T03970                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
scap  Staphylococcus capitis
Pathway
scap00564  Glycerophospholipid metabolism
scap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AYP1020_0610 (glpD)
Enzymes [BR:scap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AYP1020_0610 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored Pyr_redox NAD_binding_8 Lycopene_cycl GIDA Thi4 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKL91757
LinkDB All DBs
Position
617584..619257
Genome map
AA seq 557 aa AA seqDB search
MALSTLKRDHIKKNLRENEYDVVIVGGGITGAGIALDASNRGMKVALVEMQDFAQGTSSR
STKLVHGGLRYLKQLQVGVVAETGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTAI
GLTMYDRLAGVKKSERKKMLSRQDTLDKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKK
AAEKGAEIINYTRSEHFTYDSNKKVNGIEVLDMIDGETYGIKAKKVINASGPWVDEVRSG
DYARNNKQLRLTKGVHVVIDQSKFPLGQAVYFDTEKDGRMIFAIPREGKAYVGTTDTFYD
NEKATPLTTQEDRDYLIDAINYMFPSVNVKDEDIESTWAGVRPLILEEGKDPSEISRKDE
VWEGESGLLTIAGGKLTGYRHMALDIVDLLAKRLKQEHGLKFEPCATKYLKISGGDVGGS
KNYQHFVDQKVDAAKGFGIEEDVARRLASKYGSNVDHLFNIAQTAKQQDNHLPLEIYVEL
VYGIQQEMVYKPTDFLVRRSGKLYFNIQDVLDYKDAVIDVMADMLNYSDAQKESYTKEVE
EAIDQARTGNNQPAVKE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcattatctacattgaaaagagatcatatcaagaaaaatttaagagaaaatgaatat
gacgttgttatcgtcggtggtggtattacaggtgcaggtattgctcttgacgctagtaac
cgcggtatgaaagtagcattagttgaaatgcaagatttcgcacaaggtacaagttctaga
tctactaaacttgttcatggtggtttaagatatttaaaacaattacaagttggcgttgtt
gctgaaactggtaaagaacgtgcaattgtttatgagaatggtccacatgtaactacacct
gaatggatgctgttaccaatgcataaaggtggtacattcggtaaattctcaacagctatc
ggtttaacaatgtatgatagactagctggtgttaaaaaatctgaacgtaaaaaaatgtta
tctagacaagatacactagataaagaaccactagttaaacaagaaggcttaaaaggtggc
ggttattacgttgaataccgtactgatgacgctcgtttaactattgaagttatgaaaaaa
gcagctgaaaaaggtgcagaaatcattaactatactcgttcagaacatttcacttatgat
tcaaataaaaaagttaatggtatcgaagtattagatatgattgacggagaaacatacggt
attaaagctaaaaaagtaattaatgcttctggtccatgggttgatgaagtgagaagtggt
gactatgcacgtaataataaacaactacgtttaactaaaggtgtgcatgttgttatcgac
caatctaaattcccattaggccaagcagtttatttcgacactgaaaaagatggtcgtatg
attttcgctatacctcgtgaaggtaaagcatatgttggtacaactgatactttctatgat
aacgaaaaagcaacaccattaactacacaagaagatagagattatctcattgatgcgatt
aattacatgttcccaagtgttaatgttaaagatgaagatatcgaatcaacttgggcaggt
gttcgtccattaatcttagaagaaggtaaagacccatctgaaatttctcgtaaagatgaa
gtttgggaaggtgaatcaggcctacttactattgctggtggtaagttaacaggttatcgt
catatggcactagatattgttgacttattagctaaacgtttaaaacaagaacatggactt
aaatttgaaccatgtgcaactaaatatcttaaaatttctggcggtgacgtaggtggtagt
aaaaactatcaacactttgttgaccaaaaagttgacgcagccaaaggatttggtattgaa
gaagatgttgcacgtagattagctagtaaatatggttctaacgtagatcatttattcaac
atagctcaaactgctaaacaacaagataatcatttaccattggaaatttatgtggaatta
gtttacggaatccaacaagaaatggtttacaaaccaactgacttcttagtacgtcgttca
ggtaaattatacttcaatattcaagatgttttagattataaagatgctgttattgacgtt
atggctgacatgcttaactattcagatgctcaaaaagagtcttacactaaagaagtagaa
gaagcaattgatcaagcacgtactggaaataatcaaccagcagttaaagaataa

DBGET integrated database retrieval system