KEGG   Staphylococcus capitis: AYP1020_1309Help
Entry
AYP1020_1309      CDS       T03970                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scap  Staphylococcus capitis
Pathway
scap00010  Glycolysis / Gluconeogenesis
scap00071  Fatty acid degradation
scap00280  Valine, leucine and isoleucine degradation
scap00310  Lysine degradation
scap00330  Arginine and proline metabolism
scap00340  Histidine metabolism
scap00380  Tryptophan metabolism
scap00410  beta-Alanine metabolism
scap00561  Glycerolipid metabolism
scap00620  Pyruvate metabolism
scap00625  Chloroalkane and chloroalkene degradation
scap01100  Metabolic pathways
scap01110  Biosynthesis of secondary metabolites
scap01120  Microbial metabolism in diverse environments
scap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYP1020_1309
   00053 Ascorbate and aldarate metabolism
    AYP1020_1309
   00620 Pyruvate metabolism
    AYP1020_1309
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYP1020_1309
   00561 Glycerolipid metabolism
    AYP1020_1309
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYP1020_1309
   00310 Lysine degradation
    AYP1020_1309
   00330 Arginine and proline metabolism
    AYP1020_1309
   00340 Histidine metabolism
    AYP1020_1309
   00380 Tryptophan metabolism
    AYP1020_1309
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYP1020_1309
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AYP1020_1309
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AYP1020_1309
Enzymes [BR:scap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AYP1020_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AKL92409
UniProt: A0A341ETG0
LinkDB All DBs
Position
complement(1336938..1338365)
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVDSASGETIDVINPATEEVMGSVANGNEEDVNKAVEAADKVYLEFRH
SSVEERRDLLDKIVKEYENRKDDIIQAITDELGSPLSVSENVHYQMGLNHFTAARDALDN
FEFEEQRGDDLVVKEAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDADIKEAAKATTGKVVNNTGQVCTAGTRVLIPESIKEDFLTAVK
EEFSQVKVGDPREDGTQVGPIISKKQFDQVQDYIDKGVNEGAELFYGGPGKPEGLDKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNDLDEAIEIANDTKYGLAGYVIGKDQETLR
KVARSVEAGTIEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatattaatggcgaatgggttgatagtgcgagtggcgaa
acaattgacgtaatcaatcctgcaactgaagaagtgatgggatctgtagctaacgggaat
gaagaagatgttaacaaagctgttgaagcggctgacaaagtttatttagaatttcgtcat
agttcagttgaagaacgtagagacttgttagataaaattgtaaaagaatatgaaaataga
aaagacgatattatccaagcgattacagatgaattaggttctccattatctgtttctgaa
aatgttcactatcaaatgggactaaatcactttacggcagcaagagatgctttagataat
tttgaatttgaagagcaacgtggagatgatttagtagttaaagaagctattggtgtctca
ggattagttacaccttggaatttccctactaatcaaacatcattaaaattagctgctgct
tttgctgcaggtagtccagtagttcttaaaccttctgaagaaacaccatttgcagctatt
atcttagcagaaatctttgataaagttggcgtacctaaaggtgtattcaatttagttaat
ggcgatggtgaaggtgtaggaaatccattaagtgaacaccctaaagtgagaatgatgtca
tttactggttctggcccaacaggatctaaaatcatggaaaaagctgcaaaagacttcaaa
aaagtgtctctagaactaggaggaaaatctccttatatcgttcttgacgatgctgatatc
aaggaagcagctaaagctacaactggcaaagttgttaataacactggccaagtatgtact
gcaggtacacgtgtacttatacctgaaagcattaaagaagatttcttaacagcagttaaa
gaagaatttagccaagttaaagtaggagatcctcgtgaagatggtacacaggtcggacca
attatcagtaaaaaacaattcgatcaagttcaagactatattgataaaggcgtaaatgaa
ggtgctgaattattctacggtggccctggtaaaccagaaggccttgataaaggttatttc
gcacgtccaactattttcatcaatgtagataaccatatgacaattgctcaagaagaaatc
ttcggtccagttatgtcagtgatcacttataatgatttagatgaagcaattgaaattgct
aatgatactaaatatggtcttgctggctacgttattggtaaagatcaagagactttacgt
aaagtagcacgttcagttgaagcaggaactattgaaatcaatgaagctggtagaaaacct
gacttaccattcggcggttataaacaatcaggtttaggtcgtgaatggggcgactatggt
attgaagaattcttagaagttaaatcaattgctggttattttaaataa

DBGET integrated database retrieval system