KEGG   Staphylococcus capitis: AYP1020_2146Help
Entry
AYP1020_2146      CDS       T03970                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
scap  Staphylococcus capitis
Brite
KEGG Orthology (KO) [BR:scap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYP1020_2146 (ahpF)
Enzymes [BR:scap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AYP1020_2146 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 FAD_binding_2 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase DAO Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKL93234
LinkDB All DBs
Position
complement(2205263..2206786)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGDVEFVASLGSDDKSKELKELLDEIADMSARITVTEKDLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSVIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESEDIMAVPAVFLDGQEFGNG
RMTIQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLEDHISQYDIDTMTGIRATNIEKTDSAIKVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTVFEYSSELKADNVLQDRLRSLSNVDIKTNARTTEVLGEDHVTGISYED
LNSGETQVVNLDGIFVQIGLVPNTAWLQDTIELNGRGEIVIDRDNATNVPGVFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattaaaacaattattagagctaatggagggcgac
gttgagttcgtcgctagccttggctcagatgataaatctaaagaacttaaagagttacta
gatgaaattgctgatatgtcagcacgcatcactgtaactgaaaaagatttaaaacgtaca
ccaagtttctctgtaaatcgcccaggtgaagaaacaggtgttacattcgcaggtattcca
ttaggtcatgagtttaactcacttgtattagcgatattacaagtaagtggccgtgctcct
aaagaaaaacaatctgtgattgatcaaattaaaggtcttgaagggccatttcatttcgaa
actttcgttagtttaacttgtcaaaaatgccctgacgttgttcaagcattgaatttgatg
agtgttattaatcctaacattacgcatactatgattgatggcgcagttttccgtgaggag
tctgaagacatcatggctgtaccagctgtcttcttagatggtcaagagttcggtaatggc
cgtatgactattcaagatattttaactaaattgggaagcactcaagatgcttctgaattt
aatgataaagacccttatgatgttctaatcgtaggtggtggtcctgcaagtggtagtgct
gctatctatactgcacgtaaagggctacgtacaggtattgttgctgaccgtattggtggt
caagttaatgatactgctggaattgaaaactttattactgttaaagaaacaacaggttct
gagttttcttctaaccttgaagatcatatctcacaatatgacattgatacgatgacaggt
atccgtgctactaatatcgagaaaactgattcagcaattaaagttactttagaaaatgat
gctgtactagaaagtaaaactgtgattatttctacaggtgcaagttggcgaaaacttaat
attcctggtgaagatcgccttattaataaaggtgtagcattctgccctcactgtgacggc
cctctatttgaaaataaagatgtcgcagttatcggtggcggtaactctggcgttgaagca
gctatcgatttagcaggaattgttaagcatgttactgtatttgaatattcatctgaatta
aaagcagataatgtcttacaagatcgtttacgttctttatcaaatgttgatattaaaacg
aacgctagaactactgaagttcttggtgaagaccatgttaccggtattagttatgaagat
ttaaatagcggtgaaactcaagtagtaaatcttgatggtattttcgttcaaatcggttta
gttcctaacactgcatggctacaagatactattgaactaaacggacgtggcgaaatagtc
atcgatcgtgataacgcgacaaacgttcctggtgtattcgcagcaggtgacgtgacagat
cagaagaataaacaaattataatttcaatgggtgctggcgctaacgctgcgttaaatgca
ttcgactatattatcagaaactaa

DBGET integrated database retrieval system