KEGG   Staphylococcus caprae: DWB96_12565Help
Entry
DWB96_12565       CDS       T06252                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
scar  Staphylococcus caprae
Brite
KEGG Orthology (KO) [BR:scar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DWB96_12565
Enzymes [BR:scar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DWB96_12565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Thi4 HI0933_like FAD_binding_2 AlaDh_PNT_C FAD_binding_3 DAO NAD_binding_8 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QDW95011
LinkDB All DBs
Position
2585021..2586544
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSKELKELLDEIAGMSARITVTEKDLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSVIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESEDIMAVPAVFLDGQEFGNG
RMTIQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLADHISQYDIDTMTGIRATNIEKTDSAIKVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYSSELKADNVLQDRLRSLENVDIKTNARTTEVIGEDHVTGISYED
LNTGETQVVNLDGIFVQIGLVPNTAWLQDAVELNGRGEVVIDRDNATSLPGVFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaactattagagctaatggaaggcgac
gttgaattcgtcgctagccttggctcagatgataaatcaaaagaacttaaagagttacta
gatgaaattgctggaatgtcagctcgcatcacggtaactgaaaaggatttaaaacgtaca
ccaagtttctcagtaaaccgcccaggtgaagaaactggcatcacgtttgcaggtattcct
ttaggtcacgaattcaactctcttgtattagcaattttacaagtaagtggtcgtgcccct
aaagaaaaacaatctgttattgaccaaatcaaaggcctcgaaggtcccttccatttcgaa
actttcgttagtttaacttgccaaaaatgccctgacgttgttcaagcattaaacttaatg
agtgttattaaccctaatattactcatacaatgattgatggcgcagtattccgcgaagaa
tctgaagacattatggcagttccagctgtctttttagatggacaagaatttggtaatggt
cgtatgactattcaagatatcttaacgaaattaggaagcacacaagatgcttctgaattt
aatgataaagacccttatgatgtactcatcgtaggcggtggcccagcaagtggtagtgct
gccatttacactgctcgtaaaggtttaagaacaggcatcgttgctgatagaattggtggc
caagtgaatgatacagctggcattgaaaacttcattactgttaaagaaacaacaggttca
gagttctcatctaatcttgctgatcatatttcacaatatgacattgatacaatgactggt
attcgtgccactaatatcgaaaagacagactcagcaatcaaagtcactttagagaatgat
gctgtattagaaagtaagactgtgattatctctacaggtgcaagttggcgtaaacttaat
attcctggagaagatcgccttatcaataaaggtgtagcattctgccctcactgtgacggc
cctctatttgaaaacaaagacgtagcagttatcggtggcggtaactctggtgtcgaagca
gctattgatttagctggtattgttaagcacgtaacattatttgaatattcttctgaatta
aaagcagataatgttttacaagatcgtttacgttcattggaaaacgtcgacatcaaaacg
aatgctagaactacagaggttatcggcgaagaccacgtaactggtattagttatgaggat
ttaaatactggcgaaacacaagtagtcaaccttgatggaatctttgttcaaatcggctta
gtcccaaatactgcatggttacaagatgcagttgagttaaatggacgtggcgaagtcgtt
atcgatcgtgataacgctacaagccttcctggtgtattcgcagcaggagacgtaacagac
cagaaaaacaaacaaatcatcatttcaatgggcgctggcgctaacgcagcgttgaacgca
tttgattatattattagaaattaa

DBGET integrated database retrieval system