KEGG   Streptomyces scabiei: SCAB_29931Help
Entry
SCAB_29931        CDS       T01187                                 

Gene name
sodN
Definition
(GenBank) putative nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
scb  Streptomyces scabiei
Brite
KEGG Orthology (KO) [BR:scb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCAB_29931 (sodN)
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SCAB_29931 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: CBG70098
UniProt: C9ZAA4
LinkDB All DBs
Position
3407057..3407452
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQDKMAANDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDALKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggtgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtgcaggac
aagatggccgccaacgacgaccctcacttccaggctcgcgcgaccgtcatcaaggagcag
cgcgccgagctcgccaagcaccacgtctcggtgctgtggagcgactacttcaagcctccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacgccctgaaggccctctcg
gccgccaaggcgtccaccgacccggcgacgggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system