Streptomyces scabiei: SCAB_3331 Help Entry SCAB_3331         CDS       T01187                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism scb  Streptomyces scabiei Pathway scb00261   Monobactam biosynthesis scb01100   Metabolic pathways scb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCAB_3331  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:scb01008]     SCAB_3331 Polyketide biosynthesis proteins [BR:scb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCAB_3331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBG67542 UniProt:  C9ZGA1 LinkDB All DBs Position 381487..381696 Genome browser AA seq 69 aa AA seqDB search MTNPFENPDGIYRVLTNDEGQHSLWPDFTPVPEGWATVFGPDSRTACLEYVEREWTDLRP QSLVRAMGE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgagaaccccgacggcatctaccgggtcctgaccaacgacgagggc cagcactcgctgtggcccgacttcacccccgtgcccgaaggctgggccaccgtcttcggc ccggacagccgcaccgcctgcctggagtacgtcgaacgcgagtggaccgacctgcgcccc cagagcctcgtccgggccatgggcgagtga

DBGET integrated database retrieval system