KEGG   Streptomyces scabiei: SCAB_39221Help
Entry
SCAB_39221        CDS       T01187                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
scb  Streptomyces scabiei
Pathway
scb00330  Arginine and proline metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01130  Biosynthesis of antibiotics
scb01230  Biosynthesis of amino acids
Module
scb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SCAB_39221
Enzymes [BR:scb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     SCAB_39221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N Shikimate_DH ApbA Rossmann-like 2-Hacid_dh_C IlvN PDH GFO_IDH_MocA TrkA_N
Motif
Other DBs
NCBI-ProteinID: CBG71002
UniProt: C9YZD9
LinkDB All DBs
Position
complement(4406650..4407501)
Genome map
AA seq 283 aa AA seqDB search
MAPGRRTPEGTRTMSQKVAVLGTGKIGEALLSGMIRAGWAPADLLVTARRPERAEELRTR
YGVTPVTNAEAAKTADTLILTVKPQDMATLLDELAPHTPADRLVVSGAAGIPTSFFEERL
AAGTPVVRVMTNTPALVDEAMSVISAGSHASEADLAHAEEIFGAVGKTLRVPESQQDACT
ALSGSGPAYFFYLVEAMTDAGILLGLPRDKAHDLIVQSAIGAATMLRDSGEHPVKLRENV
TSPAGTTISAIRELENHGVRAALIAALEAARDRSRELASGKKD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccccaggacgacgcaccccggagggcacccgcaccatgagccagaaagtcgcagtc
ctcggtaccggcaagatcggcgaggccctgctcagcggcatgatccgagccggctgggcg
cccgcggacctcctggtcaccgcccgccgccccgaacgcgccgaagagctccgcacccgc
tacggcgtcacaccggtcaccaacgccgaggccgcgaagaccgccgacacgctcatcctc
acggtcaagccccaggacatggccaccctcctcgacgaactcgccccgcacacccccgcc
gaccgcctggtcgtcagcggcgcggcaggcattcccacctccttcttcgaggagcgcctg
gccgcaggcacccccgtcgtccgtgtcatgacgaacacccccgccctcgtggacgaggcc
atgtccgtcatctccgccggcagtcacgcgagcgaggccgatctcgcgcacgccgaggag
atcttcggcgccgtcggcaagacgctccgcgtccccgagtcccagcaggacgcctgcacc
gccctctccggctccggcccggcgtacttcttctacctggtcgaagccatgaccgacgcg
ggcatcctcctgggcctgccccgggacaaggcccacgacctgatcgtccagtccgccatc
ggcgcggccacgatgctccgcgacagcggcgaacaccccgtgaagctccgggagaacgtc
acctctcccgccggcacgacgatcagcgccatccgcgaactcgagaaccacggagtgcgc
gccgcactgatcgccgcgctggaggccgcccgcgaccgcagccgcgaactggcctccggc
aagaaggactga

DBGET integrated database retrieval system