KEGG   Streptomyces scabiei: SCAB_54111Help
Entry
SCAB_54111        CDS       T01187                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scb  Streptomyces scabiei
Pathway
scb00620  Pyruvate metabolism
scb00680  Methane metabolism
scb01100  Metabolic pathways
scb01120  Microbial metabolism in diverse environments
scb01200  Carbon metabolism
Module
scb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCAB_54111 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SCAB_54111 (ppc)
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SCAB_54111 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBG72447
UniProt: C9YY08
LinkDB All DBs
Position
6008072..6010804
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTVSSELRADIRRLGDLLGETLVRQEGPDLLELVERVRSLTREDGEAAADLL
RGTELETAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLARTADRLKDADPEHV
RETVGNLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVIDSDRRRHDTRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVTIPDATRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALELIDELRGFLSNSIRYTGATEDLLTSL
RADLEALPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGIPHEDGRDYLGTGELL
KDLTLIQTSLREHRGGLFADGRMNRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYEDMPREYRHKLLARELRSRRPLGPTPAPLDAAGAKTLGVFETVKKALAVFGPE
VIESYIISMCQGADDVFAATVLAREAGLVDLHAGWARIGIVPLLETTDELKSADTILEEM
LADPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAAT
LQASALHTSPRQSVEALARWDAAMDLVSDAAHAAYRRLVEDPDLPTYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
HEQWHFFRNFLSNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIRTEHELTVREVLRVT
GEEKLLDANPVLQQTFSIRDAYLDPISYLQVALLKRQRDAAAAGEEADPLLARALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacggtcagcagcgaactgcgcgccgacatccgg
cgcctgggcgacctgctgggcgagaccctcgtacggcaggagggccccgacctcctggag
ctggtcgagcgcgtccgcagcctgacccgcgaggacggcgaagccgccgccgacctgctg
cgcggcaccgagctggagaccgccgccaagctcgtccgcgccttctccacctacttccac
ctggccaacgtcaccgaacaggtgcaccgcggccgcgagctgagggcacgccgtgccgcc
gagggcggcctgctcgcccgtacggccgaccgcctgaaggacgccgaccccgaacacgta
cgcgaaacggtcgggaacctcaacgtccgccccgtcttcaccgcccaccccaccgaagcg
gcacgccggtcggtcctcaacaagctccggcgcatcgccgcgctgctggagacccccgtc
atcgactccgaccgccgccgccacgacacccgactggccgagaacatcgacctcgtctgg
cagaccgacgaactgcgcgtcgtacgccccgagcccgccgacgaggcccgcaacgccatc
tactacctggacgaactgcacgccggtgcggtcggcgacgtcctggaggacctgacggcc
gagctggagcgggtcggcgtcaccatccccgacgccacccgccctctcaccttcggcacc
tggatcggcggcgaccgcgacggaaaccccaacgtcaccccccaggtgacctgggacgtc
ctcatcctccagcacgaacacggcatcaacgacgccctcgaactcatcgacgaactgcgc
ggcttcctctccaactccatccgctacaccggagccaccgaggacctgctgacctccctc
cgggccgacctcgaagccctccccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccgcctcaaggccacctgcatccggcagaagctggagaacaccaagcagcgc
ctggccaagggcatcccgcacgaggacggccgcgactacctcggcaccggtgagctcctc
aaggacctcaccctcatccagacctcgctgcgcgagcaccgcggcggcctcttcgccgac
ggccggatgaaccgcaccatccgcaccctggccgccttcggcctccagctcgccaccatg
gacgtccgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgaccggctc
ggcgaggagtcctggcgctacgaggacatgccccgcgagtaccgccacaagctcctcgcc
cgcgagctgcgctcccgacgcccgctcggtcccaccccggcaccgctggacgccgccggc
gccaagaccctcggcgtcttcgagaccgtcaagaaggcgctcgccgtcttcggccccgag
gtcatcgagtcctacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccacc
gtcctcgcccgcgaggccggcctcgtcgacctgcacgccggctgggccaggatcggcatc
gtgccgctgctggagaccaccgacgagctcaagtccgccgacacgatcctcgaagagatg
ctcgccgacccctcctaccgacggctcgtcgccctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcgtcgaagttcggcggcatcaccacctcgcagtgggagatccac
cgggcccagcgccggctgcgcgacgtcgcgcaccgctacggcgtacgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgtggcggcggcccctcgcacgacgcgatcctcgcg
cagccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctcc
gacaagtacctcgtgccgtccctggcccgggagaacctcgaactcaccgtcgcggcgacc
ctgcaggcgtccgcgctgcacacctccccccgccagtcggtcgaggccctcgcccgctgg
gacgcggccatggacctggtcagcgacgccgcccatgcggcctaccgccgactggtcgag
gaccccgacctgccgacgtacttcctcgcctcgacaccggtcgaccagctcgccgacctg
cacctcggctcgcggccctcccgtcgccccggctcgggcgtctccctcgacgggctgcgc
gccatcccctgggtgttcggctggacccagtcacggcagatcgtgcccggctggttcggc
gtcggctcgggcctgaaggcactgcgcgaagccggcctggacaccgtgctcgacgagatg
cacgagcagtggcacttcttccgcaacttcctctccaacgtcgagatgacgctggccaag
acggacctgcggatcgcccagcactacgtcgacaccctcgtccccgacgagctgaagcac
gtcttcgacaccatccggaccgaacacgagctgaccgtccgcgaggtgctgcgcgtcacc
ggcgaggagaagctgctcgacgccaaccccgtcctgcagcagaccttctccatccgcgac
gcctacctcgacccgatctcgtatctccaggtcgccctgctcaagcggcagcgggacgct
gccgcggcgggggaggaggccgacccgctgctggcccgggccctgctgctcacggtcaac
ggtgtggccgctgggttgcgcaacacgggctga

DBGET integrated database retrieval system