KEGG   Streptomyces scabiei: SCAB_57701Help
Entry
SCAB_57701        CDS       T01187                                 

Definition
(GenBank) putative beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
scb  Streptomyces scabiei
Pathway
scb00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCAB_57701
Enzymes [BR:scb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCAB_57701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Cellulase Glyco_hydro_2_C DUF4434 Cupin_3
Motif
Other DBs
NCBI-ProteinID: CBG72795
UniProt: C9Z446
LinkDB All DBs
Position
6423401..6425419
Genome map
AA seq 672 aa AA seqDB search
MKRELKVPGIAYGGDYNPEQWPEEVWAEDVRLMREAGVNMVSVNIFAWALIEPREGEYDF
SRLDRILALLHENGIAADLATPTAAPPAWFFVKHPEALPVDKDGRTLSYGSRQTFCPSSP
AYREAALRIARVLGERYADHPAVVMWHIHNEYGCHNGECHCDTSAAAFRVWLREKYEDDL
AALNHAWGTTFWSQWYYDWDEIIPPRPTGAVPNPTHQLDWRRFCSDALLSLYKAEREVLL
EAAPATPATTNFMVMFNFDKLDYWRWAPELDIVSNDHYLQSTDPESEIDIALSGDLVRSL
GGGSPWLLMEHSTGAVNWQPVNRAKTAGELRRNALSHVARGADGIAYFQWRAAKAGAEQW
HSAMLPHAGTDSQIWRDVVRLGADLRALAEVRGSEGVAEVAVVWDWSAWWAVELPSQPSG
ELRFQDLVRAWYEPLWRAGVAVDFVRPDADLSSYKLVLAPSLYLVDDAGAANLTGFAEAG
GTLAVGFHSGAVDENCHVRLGGYPGAFREALGVRTDELFPLLPGESVGLSDGGTAGLWSE
RVALAGAEAVTSYTSGPLTGVPAVTRHTHGTGTAWYVATRPDPTALASLLARIAEDAGVA
SVRPTPEGVEAALRRGADADYLFLINHGGTDVEVTVSADASELLTGKGIATTDGSTTVSV
PAGDVAVVREPR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaactgaaggtccccggcatcgcctacggcggggactacaaccccgagcag
tggcccgaggaggtctgggccgaggacgtacgcctcatgcgtgaggcgggcgtgaacatg
gtcagcgtcaacatcttcgcgtgggcgctgatcgagccgcgcgagggcgagtacgacttc
tcccgcctcgacaggatcctcgccctgctccacgagaacggcatcgccgccgacctggcg
acgccgacggccgccccgccggcctggttcttcgtcaagcacccggaggccctgccggtc
gacaaggacggccgcaccctctcctacggcagccggcagaccttctgcccctccagcccc
gcctaccgcgaggccgccctgcggatcgcccgcgtgctcggcgagcggtacgccgaccac
ccggccgtcgtcatgtggcacatccacaacgagtacggctgccacaacggcgagtgccac
tgcgacaccagcgccgcggccttccgggtctggctgcgcgagaagtacgaggacgacctg
gcggcgctcaaccacgcctggggcacgacgttctggagccagtggtactacgactgggac
gagatcatcccgccccgcccgaccggcgcggtcccgaacccgacccaccagctggactgg
cgccgcttctgcagcgacgccctgctgtcgctgtacaaggccgagcgcgaggtgctgctg
gaggcggcccccgccaccccggccaccaccaacttcatggtgatgttcaacttcgacaag
ctcgactactggcgctgggcacccgagctggacatcgtctccaacgaccactacctccag
tcgacggaccccgagtccgagatcgacatcgcgctcagcggcgacctcgtgcgctcgctg
ggcggcgggagcccgtggctgctgatggaacactccaccggcgcggtcaactggcagccc
gtcaaccgggccaagacggccggagagctgcgccgcaacgccctgtcccacgtggcccgg
ggcgccgacggcatcgcctacttccagtggcgggccgccaaggcgggcgccgagcagtgg
cactcggcgatgctcccgcacgcgggcacggacagccagatctggcgggacgtggtccga
ctgggcgcggatctgcgggcgttggcggaggtgcggggcagcgaaggcgtcgccgaggtc
gccgtcgtctgggactggagcgcctggtgggcggtggaactaccgtcccagccgagcggc
gaactccgcttccaggacctggtccgtgcctggtacgagccgttgtggcgggccggtgtg
gcggtggacttcgtccgccccgacgcggacctctcctcgtacaagctggtgctggccccg
agcctgtacctggtggacgacgcgggcgcggcgaacctcaccggcttcgcggaggccggc
ggcacgctggccgtcggcttccacagcggcgcggtggacgagaactgccatgtccggctg
ggcggttacccgggcgcgttccgcgaggcgctcggcgtgcgcacggacgagctgttcccg
ctgctcccgggggagtcggtgggcctgagcgacggcggtacggccggactgtggtcggag
cgggtcgccctggccggcgcggaggcggtgacgtcgtacacctccggtcccctgaccggg
gtcccggccgtcacccgtcacacccacggcacgggcaccgcctggtacgtcgccacccga
ccggacccgacggccctcgcctccctgctggcccgtatcgccgaggacgcgggcgtggcg
tcggtgcgcccgacccccgagggcgtcgaggcggccctgcgccggggcgcggacgcggac
tacctcttcctgatcaaccacggcggcaccgacgtcgaggtcacggtctccgcggacgcg
tccgagctgctgacgggcaaggggatcgccacgacggacggttcgacgaccgtgtcggta
ccggccggcgacgtggcggtcgtccgcgaaccccgctga

DBGET integrated database retrieval system