KEGG   Streptomyces scabiei: SCAB_69871
Entry
SCAB_69871        CDS       T01187                                 

Definition
(GenBank) putative aldehyde lyase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
scb  Streptomyces scabiei
Pathway
scb00997  Biosynthesis of various secondary metabolites - part 3
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SCAB_69871
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SCAB_69871
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: CBG73981
UniProt: C9YY79
LinkDB
Position
complement(7742484..7743329)
AA seq 281 aa
MLKTGKPLRWRRLSRAGDDRHLLIPLDHSVSDGPVAPPGRWEDLLRELVAGGADGIVVHK
GRARTLAPDLLGDCALVVHLSASTACSADVDAKVLVGDVEEAVALGADAVSVHVNIGSDT
EGRQLADLGAVARSCDTWGMPLIAMVYPRGPRIENPHDPALLAHVVNVAADLGADMVKTT
VALPLERMSEVVAHSPIPVLAAGGPPDGSDLIEYGTAVMAAGCRGLAVGRRVFSSPSPTS
LVSRLAAVVHGTAGDGLPDGRGMSNQSSSSSRYSTIVAGVA
NT seq 846 nt   +upstreamnt  +downstreamnt
atgctgaaaaccggcaagccattacgttggagaaggctttcccgggccggtgatgaccgg
catttgctcatacctctggaccacagtgtctcggacggcccggtcgcccctccgggacgg
tgggaggacctgctgcgggagctggtggccggcggggccgacgggatcgtcgtccacaag
ggccgggcccgcaccctcgcgcccgacctcctcggcgactgcgcgctggtcgtgcacctg
agcgccagtacggcctgttccgccgacgtggacgccaaggtgctggtcggcgatgtcgag
gaggcggtggcactcggcgcggacgcggtcagcgtccatgtgaacatcggctcggacacc
gagggccgtcagctcgccgacctcggcgcggtggcccgctcgtgcgacacctggggcatg
cccctgatcgcgatggtctatccgcgcggcccccggatcgagaacccgcacgatcccgcc
ctgctcgcccacgtcgtgaacgtcgccgccgatctgggcgccgacatggtgaagaccacc
gtcgccctgccgctggaacggatgtccgaggtggtggcccacagccccatccccgtcctc
gcggccggtggcccgccggacggctccgacctgatcgagtacggcaccgccgtgatggcg
gccggctgccggggactcgccgtcggccgtcgggtcttctcctccccctcccccacctcc
ctggtctcccgcctcgccgcggtggtgcacggcaccgccggcgacggcctcccggacggc
aggggcatgtccaaccagtcctcttcctcttcccgttactcgacgatcgtggcaggtgtc
gcatga

DBGET integrated database retrieval system