KEGG   Streptomyces scabiei: SCAB_79311Help
Entry
SCAB_79311        CDS       T01187                                 

Definition
(GenBank) putative aminotransferase (fragment)
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scb  Streptomyces scabiei
Pathway
scb00250  Alanine, aspartate and glutamate metabolism
scb00410  beta-Alanine metabolism
scb00640  Propanoate metabolism
scb00650  Butanoate metabolism
scb01100  Metabolic pathways
scb01120  Microbial metabolism in diverse environments
Module
scb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAB_79311
   00650 Butanoate metabolism
    SCAB_79311
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAB_79311
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_79311
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scb01007]
    SCAB_79311
Enzymes [BR:scb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCAB_79311
Amino acid related enzymes [BR:scb01007]
 Aminotransferase (transaminase)
  Class III
   SCAB_79311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CBG74891
UniProt: C9ZEA0
LinkDB All DBs
Position
8762954..8764222
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAARGEGVHLFAEDGRRYLDFTAGIGVTSTGHCHPKVVAAAQEQVG
SLIHGQYTTVMHEPLRRLVEKLGEVLPTGLDSLFFTNSGSEAVEAALRLARQATGRPNVI
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPAAHRYGWDEETATRFALNEL
DYILQTISSPADTAAIIVEPVLGEGGYVPANRTFMEGLRERADRHGFLLVLDEVQTGVGR
TGRFWGHDHFGVTPDILVTAKGLASGFPLSGIAASEELMAKAWPGSQGGTYGANAVACAA
ACATLDVVREERLVENAEAMGKRLRHGLEAVADRTPGIGDVRGLGLMLATEFVTEDGSPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDEAAVDEGLRAWATAVEAGTAGAA
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacgcccgtggtggcggcccggggtgag
ggcgtccacctcttcgccgaggacggccgccgctacctcgacttcaccgccgggatcggt
gtcaccagcaccggccactgccaccccaaggtcgtggcggcggcccaggagcaggtgggc
tcgctgatccacggccagtacacgacggtcatgcacgagccgctgcgccgcctcgtcgag
aagctgggcgaggttctccccaccggtctggacagcctgttcttcaccaactccgggagc
gaggcggtggaggccgcgctgcggctggcccgccaggccaccgggcgccccaacgtcatc
gtctgtcacggcggcttccacgggcgtacggtcgccgccgcgtccatgacgacctccggc
acccgcttccgctccggtttctccccgctgatgagcggtgtggtcgtcacccccttcccc
gccgcccaccgctacggctgggacgaggagaccgcgacccgcttcgccctgaacgagctg
gactacatcctccagacgatctcctcgcccgccgacacggccgcgatcatcgtcgagccg
gtcctcggggagggcggctacgtccccgcgaaccgcaccttcatggagggcctgcgggag
cgcgccgaccggcacggcttcctgctcgtcctcgacgaggtgcagaccggcgtcggccgt
accggccgcttctggggccacgaccacttcggtgtcaccccggacatcctcgtcaccgcc
aagggcctggccagcggcttcccgctgtcgggcatcgccgcctccgaggaactgatggcc
aaggcgtggcccggctcgcagggcggcacgtacggtgcgaacgccgtcgcctgcgccgct
gcctgcgccaccctcgacgtcgtccgcgaggagcggctcgtggagaacgccgaggcgatg
ggcaagcggctccgccacggtctggaggcggtcgccgaccggacgccggggatcggcgat
gtgcgggggctcgggctgatgctggccaccgagttcgtcaccgaggacggcagtcccgac
cccgagaccgccgcccgcgtgcagcgcgccgccgtcgacgagggcctgctcctgctgctg
tgcggcgcgtggaaccaggtcgtgcggatgatcccggcgctcgtcatcgacgaggcggcg
gtggacgagggtctccgggcgtgggcgaccgcggtcgaggccggcacagcgggtgcggca
cggcgatga

DBGET integrated database retrieval system