KEGG   Sphaerochaeta coccoides: Spico_0553Help
Entry
Spico_0553        CDS       T01469                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
scc  Sphaerochaeta coccoides
Brite
Enzymes [BR:scc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Spico_0553
Prokaryotic defense system [BR:scc02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Spico_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII PipA DUF4143 DUF4092
Motif
Other DBs
NCBI-ProteinID: AEC01781
UniProt: F4GK09
LinkDB All DBs
Position
638272..639129
Genome map
AA seq 285 aa AA seqDB search
MRDFAEWLSRFRESISDYAYYIDFAKVHKNVDTIKVELNILNSLIGSQNIEAEFDALVTK
YPDTLKCVPLLLAVRASEIYAIDEDGEFTYEFPKPNQTAAQYRVFMRKTGLFDLMEQHIV
HSLVDYATGVETGLDSNGRKNRGGHLMENLVENYLRKAGFKRDVNYFKEMKLADIESKWG
LNLSALSNDGKTVKRFDFVVKTEQTVFAIETNFYASSGSKLNETARSYKNIAQEAQSIDG
FAFVWFTDGKGWISARHNLEETFDVMEHIYSISDLENGVMGRIFR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagagactttgccgaatggctttctcgtttccgagagagcatcagcgattatgcctat
tacattgactttgccaaggttcacaagaatgttgatacaatcaaggttgaactgaatatc
ctgaactcactgattggctcgcaaaacatcgaggcagagtttgatgctctagtcacgaaa
tacccggacacgctgaaatgcgtacccctcttgcttgcggtcagggcgagcgaaatttac
gctattgacgaggatggtgagtttacatatgagttccccaaacccaaccagaccgctgcg
cagtacagggtatttatgcgaaaaacaggactctttgatctaatggagcaacacattgtc
catagccttgtggactacgcgacaggtgtggaaaccgggcttgatagtaatgggcgcaag
aaccgaggcggtcacttgatggagaatcttgttgagaactatcttcgcaaggctggcttt
aagcgcgatgtcaactacttcaaagaaatgaagcttgctgatattgagagcaaatggggt
cttaatctgtcggcactgagtaatgatggtaagacggtcaaacggtttgatttcgttgtc
aagacggagcaaacagtctttgccattgaaacgaacttctatgcgagtagcggctcgaag
ctgaatgagacggcgcggagctacaaaaacattgcacaagaggcacagagtattgatggg
tttgctttcgtctggttcactgacggtaaggggtggatttccgcaagacacaatcttgaa
gaaaccttcgatgtgatggagcacatatatagtatttcagacttagagaacggagtaatg
ggcaggatatttcgatga

DBGET integrated database retrieval system