KEGG   Sphaerochaeta coccoides: Spico_1261Help
Entry
Spico_1261        CDS       T01469                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00040  Pentose and glucuronate interconversions
scc00051  Fructose and mannose metabolism
scc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spico_1261
   00051 Fructose and mannose metabolism
    Spico_1261
Enzymes [BR:scc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Spico_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEC02470
UniProt: F4GLS6
LinkDB All DBs
Position
1465868..1466845
Genome map
AA seq 325 aa AA seqDB search
MNKYSVILGNLGNTCDRFLSSGYKEIPPKETLIRQASEINGVKGLELVGTWDVNKDNVNE
MGDLLSKYGLECVSIIPDLFAQRRWGKGSISAKDPAIRAQAMEYLYECVETARILKCGTL
NIWPGQDGYDYILQSDLIQERRWLEENITTLAKSAPDIRFALEYKPKEPRNFSFMARAAD
TLLLAQRTGMDNVGVCIDTGHGYAAGENVGESVVILQEYGKKLFHMHFNDNYGGWDDDMI
VGSVHFPTYVETLFWLKETGYDGWLSMDQYPYREDGKRAVEESVLFLQMIEKHLDSPKVM
DELRSLVTRGNAVETQKWLRETFYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtattctgtcatactgggaaacctgggcaatacatgcgacaggttcctctca
tccggctacaaggaaatcccccccaaggaaaccctgatcagacaggcttctgagattaat
ggagtaaaaggtctggaattggtcggtacgtgggatgtaaacaaggacaatgtcaatgag
atgggtgacctgctctcgaaatacggcctggaatgcgtgtcaatcattcccgacctgttt
gcccagcgccgctgggggaaaggctccatttccgcgaaggatccggctatccgcgcacag
gccatggagtatctttacgaatgcgtcgagacagcccgtatcttgaaatgcgggacattg
aacatctggccgggacaggacggctatgattacatcctgcaatcagacctgattcaggaa
cgccgttggcttgaagaaaacatcactacgctggccaagagtgcgccagatatccgtttt
gcgcttgagtataagccaaaagagccgcggaatttcagtttcatggctcgtgcggcggat
acgctcctgcttgcccaaagaaccggcatggacaatgtcggcgtctgcatagacaccgga
cacgggtatgcggcgggagagaacgtcggggaatctgtcgtcatcttacaggagtacgga
aaaaagttgttccatatgcatttcaacgacaattatggaggctgggacgatgacatgatt
gtgggttccgttcatttcccgacatatgtggaaacgctattctggcttaaggaaaccggt
tatgacggttggttgtccatggatcagtatccttaccgggaagacggcaaacgcgcggtc
gaggagagcgtccttttcttgcagatgattgaaaaacatctcgactctcccaaggtcatg
gatgaactgaggagcctggttacaaggggcaacgcagtcgagacccagaagtggttgcgg
gaaactttctataagtaa

DBGET integrated database retrieval system