KEGG   Sphaerochaeta coccoides: Spico_1627Help
Entry
Spico_1627        CDS       T01469                                 

Definition
(GenBank) monosaccharide ABC transporter ATP-binding protein, CUT2 family
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc02010  ABC transporters
Module
scc_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:scc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Spico_1627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:scc02000]
    Spico_1627
Enzymes [BR:scc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Spico_1627
Transporters [BR:scc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    Spico_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 SMC_N AAA_23 AAA_30 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEC02826
UniProt: F4GJS9
LinkDB All DBs
Position
1926159..1927670
Genome map
AA seq 503 aa AA seqDB search
MAEYIVEMKHITKKFPGVIALDDVSFGLKSGEVLALLGENGAGKSTLMKILSGVYLRDEG
FISLFGENIGDLNPRLAQKHGVAMIHQELNMCSHLTVTENLFLGRELISGKGTLDNKAMR
HQAQEVLARLNIDDITPDTIVGKLAVSKQQMVEIAKALLSDARVLIMDEPTSALTSKEIT
DLFSIIHKLRSEGRGIVYISHRLEELQHIVDRVIIMRDGKTITTRNFKDISMDEIISFMV
GREITEKFPTVQSPIGKKIFEVKNLCAGRAVRDISFSLNQGEIVGIAGLMGAGRTETTRA
IFGVDPKDSGSIFIDGAEVVITKPEDAISQGIVLVPEDRKKDGLCTKLSIKENIALPNLD
ILGSRFLGVINRKSERDMVDKAVENLSIKLTDIESNAANLSGGNQQKVVVGKWLARDSRV
VMFDEPTRGIDVAAKVEIYHLMNQLKQQGIGVLFVSSEMQEIIGISDRILVMCDGKLTGE
LSSQEATQEKILELATHFEKKLT
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatacattgttgaaatgaagcacatcacaaaaaaattccccggtgtcattgcc
ctggatgatgtatctttcggcttgaaaagcggagaagtcctggcattgttgggagaaaac
ggggcaggaaaatcaacgctgatgaaaattctcagcggtgtatacctacgtgatgaaggt
tttatttcactttttggggaaaatatcggcgacttgaacccgcggcttgcccagaagcat
ggcgtcgccatgattcatcaagaactaaatatgtgttcgcatctgacagtgactgaaaat
ctttttcttggccgggaacttatctcaggaaaaggcacccttgacaacaaggcaatgaga
catcaggcgcaggaagtcctggctcggctcaatattgatgatatcacgcccgacactatt
gtcggtaaattggcggtatccaagcaacagatggtggaaattgctaaagctctcctatca
gatgcgcgggtactcatcatggacgaaccgacaagtgccctgacaagcaaagaaataaca
gatttgttctccatcattcataagctccgttccgaaggccggggcatagtctatatctcg
cataggctggaggaactgcaacatattgttgatagggtcatcatcatgcgggatgggaaa
accatcacgacaagaaacttcaaagatatcagcatggatgaaatcatttcattcatggtc
gggcgagaaataacagagaaatttcccaccgtccaaagccctattggaaaaaagattttt
gaagtcaagaatctttgtgccggtcgtgctgtccgtgatataagtttttccttgaatcag
ggtgagattgtgggtatcgccggactcatgggagctggcagaacggaaacaacacgggca
attttcggcgtcgatcctaaagactctggttctattttcattgatggcgcggaagtggtc
atcacgaagccggaggacgccataagccagggaatcgtccttgtcccggaagatcgaaag
aaggatggtctctgcacaaaactttcaatcaaggaaaatattgccctacccaatcttgat
attctcggaagcaggtttctgggtgtgatcaatcggaaatcagaacgagacatggtggat
aaagccgtagaaaatctatctatcaaactgacggacatagaatcaaacgccgctaacctg
tccggtggaaatcaacagaaagttgtcgtagggaaatggctggcccgtgactcgcgcgtg
gtcatgtttgatgaaccgacacggggaatcgatgttgcggcaaaagtggaaatctatcat
ttgatgaaccagttgaaacagcagggaatcggagtcctgttcgtttcttccgaaatgcag
gagatcattgggatttctgacagaatactcgtcatgtgtgatggaaaactgaccggggaa
ttatcctcccaggaagctacgcaggaaaaaatccttgaactcgccacgcattttgagaag
aaactgacatga

DBGET integrated database retrieval system